BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0899 (693 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI00015B4336 Cluster: PREDICTED: hypothetical protein;... 33 5.0 UniRef50_Q559C2 Cluster: Putative uncharacterized protein; n=2; ... 33 6.6 >UniRef50_UPI00015B4336 Cluster: PREDICTED: hypothetical protein; n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical protein - Nasonia vitripennis Length = 589 Score = 33.5 bits (73), Expect = 5.0 Identities = 20/42 (47%), Positives = 27/42 (64%) Frame = -2 Query: 149 HLSTVIYEYIKTLKAYNNLLVEILSRYLFVTNL*VITFFSKV 24 +L T+ YEYI T +L EI S+Y+FV+N VIT + KV Sbjct: 154 NLLTIWYEYIYT--GCYSLAFEIKSKYIFVSNDYVITEYKKV 193 >UniRef50_Q559C2 Cluster: Putative uncharacterized protein; n=2; Dictyostelium discoideum|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 402 Score = 33.1 bits (72), Expect = 6.6 Identities = 18/49 (36%), Positives = 29/49 (59%) Frame = -2 Query: 674 FIYNLTSTRRTY*NALACETVTT*INIEQNQNSIKTTRNNNGKLSFLKY 528 FI NL + Y N +A E +T N+E++ N+ K + NNN K++ + Y Sbjct: 63 FIPNLLESFCKYGNLIALEEIT---NLEKSNNNNKYSNNNNNKINKIIY 108 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 587,973,543 Number of Sequences: 1657284 Number of extensions: 11195659 Number of successful extensions: 21654 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20382 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21623 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 54545459628 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -