BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0899 (693 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 22 4.1 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 21 7.2 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 22.2 bits (45), Expect = 4.1 Identities = 11/40 (27%), Positives = 20/40 (50%) Frame = +3 Query: 93 KIIVSF*CFDVLVDYSR*VSSNGYLCTTV*IFKVLNHEFN 212 K ++F + V YS+ + S TT +++LN +N Sbjct: 219 KCNLTFSWYSKKVFYSKIIISGSIFMTTTSFYRILNSGYN 258 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 21.4 bits (43), Expect = 7.2 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -2 Query: 314 FLMKLIYESYLDLFH 270 FL LI +SYL ++H Sbjct: 16 FLFLLICDSYLKIYH 30 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,679 Number of Sequences: 336 Number of extensions: 3250 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18218375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -