BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0899 (693 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1782.08c |rex3||exonuclease Rex3 |Schizosaccharomyces pombe|... 28 1.1 SPBC1685.15c |klp6|sot2, SPBC649.01c|kinesin-like protein Klp6|S... 25 7.9 >SPAC1782.08c |rex3||exonuclease Rex3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 540 Score = 28.3 bits (60), Expect = 1.1 Identities = 10/30 (33%), Positives = 21/30 (70%) Frame = -2 Query: 620 ETVTT*INIEQNQNSIKTTRNNNGKLSFLK 531 + ++T +N+E+ +SIK T+N N ++ L+ Sbjct: 93 QNISTTLNLEKTNDSIKETKNENFRMDVLE 122 >SPBC1685.15c |klp6|sot2, SPBC649.01c|kinesin-like protein Klp6|Schizosaccharomyces pombe|chr 2|||Manual Length = 784 Score = 25.4 bits (53), Expect = 7.9 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +3 Query: 588 LLNVYLGSNCFTCQCILISTS 650 LL LG NC TC + IS S Sbjct: 349 LLKFSLGGNCRTCMIVCISPS 369 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,663,747 Number of Sequences: 5004 Number of extensions: 53805 Number of successful extensions: 83 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 82 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 83 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 321951680 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -