BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0899 (693 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0507 - 18871260-18871361,18871444-18871560,18871792-188721... 29 3.5 >07_03_0507 - 18871260-18871361,18871444-18871560,18871792-18872120, 18872704-18872871,18873592-18873685,18873707-18873766, 18874702-18874762,18875258-18875319,18875729-18875856, 18876783-18876852,18877472-18877630 Length = 449 Score = 29.1 bits (62), Expect = 3.5 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -2 Query: 299 IYESYLDLFHLTHNITYDTKFGLS*TFTFIKFVI 198 I ++YL L HLT I ++ F T F KFV+ Sbjct: 195 IMDAYLCLLHLTAGILVESLFNAFATAAFFKFVV 228 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,528,353 Number of Sequences: 37544 Number of extensions: 256775 Number of successful extensions: 366 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 363 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 366 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1768474200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -