BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0899 (693 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g20650.2 68415.m02422 zinc finger (C3HC4-type RING finger) fa... 30 1.3 At2g20650.1 68415.m02421 zinc finger (C3HC4-type RING finger) fa... 30 1.3 >At2g20650.2 68415.m02422 zinc finger (C3HC4-type RING finger) family protein Length = 559 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -2 Query: 299 IYESYLDLFHLTHNITYDTKFGLS*TFTFIKFVI 198 I +SYL L HLT I ++ F T F KFV+ Sbjct: 305 IMDSYLCLLHLTAGILVESLFNAFATAAFFKFVV 338 >At2g20650.1 68415.m02421 zinc finger (C3HC4-type RING finger) family protein Length = 559 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -2 Query: 299 IYESYLDLFHLTHNITYDTKFGLS*TFTFIKFVI 198 I +SYL L HLT I ++ F T F KFV+ Sbjct: 305 IMDSYLCLLHLTAGILVESLFNAFATAAFFKFVV 338 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,842,982 Number of Sequences: 28952 Number of extensions: 241090 Number of successful extensions: 381 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 375 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 381 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1477286152 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -