BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0897 (754 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles ... 26 1.4 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 23 7.7 AY752903-1|AAV30077.1| 93|Anopheles gambiae peroxidase 9 protein. 23 7.7 AF017062-1|AAC47144.2| 649|Anopheles gambiae soluble guanylyl c... 23 7.7 >M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 442 Score = 25.8 bits (54), Expect = 1.4 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +3 Query: 456 ARFHPRCQTAHRRSKQNGSTEPPYS 530 ARF P T+HR S N S+ P S Sbjct: 344 ARFDPSALTSHRSSSANCSSAAPKS 368 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 23.4 bits (48), Expect = 7.7 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = +3 Query: 519 PPYSEPRFEEIKKEVSSYIKKIGYNPAAVAF 611 PP+S +KK+ Y+++ N +A F Sbjct: 333 PPWSNRTLRNLKKDRMKYLRRYRLNRSAFNF 363 >AY752903-1|AAV30077.1| 93|Anopheles gambiae peroxidase 9 protein. Length = 93 Score = 23.4 bits (48), Expect = 7.7 Identities = 7/20 (35%), Positives = 13/20 (65%) Frame = +2 Query: 626 MARRQHVGAFNQMPWFKGWQ 685 +A+ QH+ + +P F GW+ Sbjct: 19 IAQYQHINYYEWLPIFLGWE 38 >AF017062-1|AAC47144.2| 649|Anopheles gambiae soluble guanylyl cyclase beta subunit protein. Length = 649 Score = 23.4 bits (48), Expect = 7.7 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = +1 Query: 472 GVKQLIVGVNKMVPLNHHTVSPDLRKSRRK 561 G++ +++G+ K V H V +++ RRK Sbjct: 138 GLEHIVIGIVKAVASKLHGVDVEIKIIRRK 167 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 841,468 Number of Sequences: 2352 Number of extensions: 18554 Number of successful extensions: 36 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77755161 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -