BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0896 (761 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X84076-1|CAA58883.1| 550|Homo sapiens DGCR2 gene protein. 33 0.84 X83545-1|CAA58536.1| 550|Homo sapiens cell surface protein prot... 33 0.84 D79985-1|BAA11480.1| 550|Homo sapiens KIAA0163 protein. 33 0.84 CR456433-1|CAG30319.1| 550|Homo sapiens DGCR2 protein. 33 0.84 BC040500-1|AAH40500.1| 550|Homo sapiens DiGeorge syndrome criti... 33 0.84 BC032430-1|AAH32430.1| 550|Homo sapiens DiGeorge syndrome criti... 33 0.84 >X84076-1|CAA58883.1| 550|Homo sapiens DGCR2 gene protein. Length = 550 Score = 33.5 bits (73), Expect = 0.84 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = +2 Query: 194 VALSMVMKLESMRKLCPTSWNRRSHAYRGNATCSLLYMSAANY 322 V ++ ++ S CPT W H Y G A+C +Y+S NY Sbjct: 100 VNVAQPVRFSSFLGKCPTGW----HHYEGTASCYRVYLSGENY 138 >X83545-1|CAA58536.1| 550|Homo sapiens cell surface protein protein. Length = 550 Score = 33.5 bits (73), Expect = 0.84 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = +2 Query: 194 VALSMVMKLESMRKLCPTSWNRRSHAYRGNATCSLLYMSAANY 322 V ++ ++ S CPT W H Y G A+C +Y+S NY Sbjct: 100 VNVAQPVRFSSFLGKCPTGW----HHYEGTASCYRVYLSGENY 138 >D79985-1|BAA11480.1| 550|Homo sapiens KIAA0163 protein. Length = 550 Score = 33.5 bits (73), Expect = 0.84 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = +2 Query: 194 VALSMVMKLESMRKLCPTSWNRRSHAYRGNATCSLLYMSAANY 322 V ++ ++ S CPT W H Y G A+C +Y+S NY Sbjct: 100 VNVAQPVRFSSFLGKCPTGW----HHYEGTASCYRVYLSGENY 138 >CR456433-1|CAG30319.1| 550|Homo sapiens DGCR2 protein. Length = 550 Score = 33.5 bits (73), Expect = 0.84 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = +2 Query: 194 VALSMVMKLESMRKLCPTSWNRRSHAYRGNATCSLLYMSAANY 322 V ++ ++ S CPT W H Y G A+C +Y+S NY Sbjct: 100 VNVAQPVRFSSFLGKCPTGW----HHYEGTASCYRVYLSGENY 138 >BC040500-1|AAH40500.1| 550|Homo sapiens DiGeorge syndrome critical region gene 2 protein. Length = 550 Score = 33.5 bits (73), Expect = 0.84 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = +2 Query: 194 VALSMVMKLESMRKLCPTSWNRRSHAYRGNATCSLLYMSAANY 322 V ++ ++ S CPT W H Y G A+C +Y+S NY Sbjct: 100 VNVAQPVRFSSFLGKCPTGW----HHYEGTASCYRVYLSGENY 138 >BC032430-1|AAH32430.1| 550|Homo sapiens DiGeorge syndrome critical region gene 2 protein. Length = 550 Score = 33.5 bits (73), Expect = 0.84 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = +2 Query: 194 VALSMVMKLESMRKLCPTSWNRRSHAYRGNATCSLLYMSAANY 322 V ++ ++ S CPT W H Y G A+C +Y+S NY Sbjct: 100 VNVAQPVRFSSFLGKCPTGW----HHYEGTASCYRVYLSGENY 138 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 100,423,668 Number of Sequences: 237096 Number of extensions: 1950396 Number of successful extensions: 3158 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3055 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3158 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9144232952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -