BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0893 (580 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16967| Best HMM Match : Laminin_EGF (HMM E-Value=0) 30 1.2 SB_1231| Best HMM Match : UCH (HMM E-Value=1e-13) 27 8.4 >SB_16967| Best HMM Match : Laminin_EGF (HMM E-Value=0) Length = 1706 Score = 30.3 bits (65), Expect = 1.2 Identities = 30/93 (32%), Positives = 44/93 (47%) Frame = +3 Query: 21 SALSPT*RGSDRILGSILAPGITDVHQR*YNYDTWINLQVNNTIEQILDFTEDSDKLLGF 200 S + T R DR L ++LA I+ V R DT + +QVNNT+E + D D L Sbjct: 1180 SRAAATERDLDRAL-AVLAGDISRVFNR--TRDT-LRVQVNNTLEVGVRVAADHDMLREH 1235 Query: 201 PTRVHVTTNSTLTSDHPLSLRPHNRKACPHGNS 299 T+V S ++ H S+R + H N+ Sbjct: 1236 VTKVAAHVRSGYSTLHD-SVRAKINRLLQHVNN 1267 >SB_1231| Best HMM Match : UCH (HMM E-Value=1e-13) Length = 969 Score = 27.5 bits (58), Expect = 8.4 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -2 Query: 522 ELGFTSPHLPCPVLCRNLRPSSVLCRTDTLALLDVVSC 409 EL SP+LP P C + SV C +TL + +C Sbjct: 686 ELTLGSPYLPSPGECSVMSCLSVFCAKETLTGKNKFAC 723 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,057,458 Number of Sequences: 59808 Number of extensions: 412361 Number of successful extensions: 1096 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1036 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1096 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1385833362 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -