BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0893 (580 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 22 5.0 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 22 5.0 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 8.8 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.8 bits (44), Expect = 5.0 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +1 Query: 229 VHSQVIILYHYGHTTERRVLMGTPVGATDR 318 +HS ++ GH R L G V T R Sbjct: 514 IHSGEVVTGVIGHRMPRYCLFGNTVNLTSR 543 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.8 bits (44), Expect = 5.0 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +1 Query: 229 VHSQVIILYHYGHTTERRVLMGTPVGATDR 318 +HS ++ GH R L G V T R Sbjct: 514 IHSGEVVTGVIGHRMPRYCLFGNTVNLTSR 543 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.0 bits (42), Expect = 8.8 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = -1 Query: 457 SFMSYGYVSATGRRQLY 407 + YGYVS +R +Y Sbjct: 660 NIFKYGYVSHANQRNMY 676 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,529 Number of Sequences: 438 Number of extensions: 4008 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16748661 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -