BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0891 (814 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 80 9e-17 EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. 27 0.69 AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. 25 2.1 AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcript... 25 2.1 AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. 25 2.8 CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein... 24 6.4 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 79.8 bits (188), Expect = 9e-17 Identities = 49/139 (35%), Positives = 76/139 (54%), Gaps = 3/139 (2%) Frame = +1 Query: 352 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKI*LAY-QT 528 +V VSG + ++ FE + + V V+ Y +PTPIQ PI ++G+ +A QT Sbjct: 161 QVRVSGENPPDHVESFERSGLREEVMTNVRKSSYTKPTPIQRYAIPIILNGRDLMACAQT 220 Query: 529 GSGKTLAYILPAIVHI-NNQPPIR-RGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRN 702 GSGKT A++LP I H+ + + + R P +++APTRELA QI F H + ++ Sbjct: 221 GSGKTAAFMLPMIHHLLDKEDSLELRTRNPYIVIVAPTRELAIQIHDEGRKFAHGTKLKV 280 Query: 703 TCVFGGAPKREQARDLERG 759 +GG + Q + L RG Sbjct: 281 CVSYGGTAVQHQLQ-LMRG 298 Score = 31.5 bits (68), Expect = 0.032 Identities = 10/19 (52%), Positives = 17/19 (89%) Frame = +3 Query: 756 GSKIVIATPGRLIDFLEKG 812 G +++ATPGRL+DF+++G Sbjct: 299 GCHVLVATPGRLLDFIDRG 317 >EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. Length = 452 Score = 27.1 bits (57), Expect = 0.69 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +3 Query: 105 TVVPNLEEATNSAIILLDLATVAIDLEDLEDLVGKKNSLE 224 T++ +L+E S + LDL ID +L +L +SLE Sbjct: 140 TMLRDLDEGCRSRVQYLDLKLNEIDTVNLAELAASSDSLE 179 >AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. Length = 437 Score = 25.4 bits (53), Expect = 2.1 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -2 Query: 591 RRLVVYVHNGWQDVGQRFAGTRLVRQLNLSRH-SYRPALSL 472 RRL + N DV A RL R+LNL+++ +Y +L+L Sbjct: 159 RRLWFGIANIEDDVSVLMAELRLYRKLNLNKYTTYNTSLTL 199 >AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcriptase protein. Length = 988 Score = 25.4 bits (53), Expect = 2.1 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 7/45 (15%) Frame = -3 Query: 281 FLLKGWSETNPNL---GDACSDLQRILF----SHQILQILQIYCH 168 F+ KG E +PN GDA D++ +LF S +I +Q CH Sbjct: 926 FVEKGILEGSPNCPECGDAVEDVEHVLFHCPRSDRIRNEMQQRCH 970 >AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. Length = 471 Score = 25.0 bits (52), Expect = 2.8 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = -1 Query: 154 RRIIAEFVASSKFGTTVSTAIIPVTRHDYFSDLVEDVYLNYGFFLTQ 14 RR+ A+ A ++F ++ YF D+V DV L Y + Q Sbjct: 59 RRVRAKSKAMTEFLPLCDVLFNVISLAGYFCDVVFDVVLGYALYERQ 105 >CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein protein. Length = 415 Score = 23.8 bits (49), Expect = 6.4 Identities = 16/70 (22%), Positives = 26/70 (37%) Frame = +1 Query: 226 SEHASPRLGFVSLQPFNKNFYDPHPTVLKRSPYEVEEYRNNHEVTVSGVEVHNPIQYFEE 405 SE + +++P Y+P P VL + V E + ++ + V EE Sbjct: 97 SEDVESSIPVSTIEPNLVEVYEPPPVVLIDTGNNVVEVNTDDQIVLEDGSVEGESNEQEE 156 Query: 406 ANFPDYVQQG 435 A Y G Sbjct: 157 AQIDVYHVDG 166 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 856,260 Number of Sequences: 2352 Number of extensions: 17759 Number of successful extensions: 40 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 86071221 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -