BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0891 (814 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 82 7e-18 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 23 4.4 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 81.8 bits (193), Expect = 7e-18 Identities = 51/144 (35%), Positives = 72/144 (50%), Gaps = 5/144 (3%) Frame = +1 Query: 343 NNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKI*LA- 519 +N +V VSG V PI+ FE A + V +K GYK+PTP+Q PI M+G+ +A Sbjct: 180 DNIQVNVSGDNVPQPIESFEAAGLRNIVLDNIKKSGYKKPTPVQKHALPIIMNGRDLMAC 239 Query: 520 YQTGSGKTLAYILPAIVHINNQP----PIRRGDGPIALVLAPTRELAQQIQQVAADFGHT 687 QTGSGKT A+ +P I + + P ++++PTREL QI Q F Sbjct: 240 AQTGSGKTAAFAVPIINTLLERSVDLVVTSTYCEPQVVIVSPTRELTIQIWQQIVKFSLN 299 Query: 688 SYVRNTCVFGGAPKREQARDLERG 759 S ++ +GG Q L G Sbjct: 300 SILKTVVAYGGTSVMHQRGKLSAG 323 Score = 35.1 bits (77), Expect = 8e-04 Identities = 14/22 (63%), Positives = 18/22 (81%) Frame = +3 Query: 747 LGEGSKIVIATPGRLIDFLEKG 812 L G I++ATPGRL+DF+EKG Sbjct: 320 LSAGCHILVATPGRLLDFVEKG 341 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 22.6 bits (46), Expect = 4.4 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -1 Query: 571 AQWLARCRPTFCRNPFGTPTKSFQ 500 AQ+ C P+ R P G PT Q Sbjct: 388 AQFATPCTPSPPRGPGGVPTSVIQ 411 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 226,713 Number of Sequences: 438 Number of extensions: 5282 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25853301 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -