BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0888 (733 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g33210.1 68418.m03923 zinc finger protein-related similar to ... 29 3.2 At4g14180.1 68417.m02189 expressed protein ; expression supporte... 27 9.7 >At5g33210.1 68418.m03923 zinc finger protein-related similar to lateral root primordium 1 (LRP1) [Arabidopsis thaliana] GI:882341; contains Pfam profile PF05142: Domain of unknown function (DUF702), TIGR01623: putative zinc finger domain, LRP1 type Length = 173 Score = 29.1 bits (62), Expect = 3.2 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +3 Query: 645 VCMCCVKYMAVCVMFCLLV 701 +C C VKY+ +C+ CLL+ Sbjct: 141 ICHCNVKYLFMCIYICLLL 159 >At4g14180.1 68417.m02189 expressed protein ; expression supported by MPSS Length = 1268 Score = 27.5 bits (58), Expect = 9.7 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 2/49 (4%) Frame = +1 Query: 1 RCLIMLCALIAVALAAP--NTIGDVPIALPSHPRGCVWILGKCSRNCEE 141 R +ML +L+ + L + I D LPS P+ +++LG+ S N +E Sbjct: 592 RIYLMLSSLVDILLEQKTGSHIRDALHCLPSDPQDLLFLLGQASSNNQE 640 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,148,823 Number of Sequences: 28952 Number of extensions: 264798 Number of successful extensions: 701 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 689 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 701 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1604469728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -