BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0887 (808 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q7RCN1 Cluster: Putative uncharacterized protein PY0574... 38 0.39 UniRef50_Q40IS5 Cluster: Peptidase S49, SppA; n=5; canis group|R... 33 8.5 UniRef50_A7AIE2 Cluster: Putative uncharacterized protein; n=2; ... 33 8.5 >UniRef50_Q7RCN1 Cluster: Putative uncharacterized protein PY05747; n=2; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein PY05747 - Plasmodium yoelii yoelii Length = 646 Score = 37.5 bits (83), Expect = 0.39 Identities = 21/59 (35%), Positives = 31/59 (52%) Frame = -1 Query: 514 NVLLKYLLNCQLRYIWP*CNFKIFINLFIMINKYFLTEIYRYSKYFESVQKRRS*TFSF 338 N+ Y+ NC L++I+P NF INLFI + + F I Y+ +F + K R F Sbjct: 63 NLNALYVPNCILKHIYPAQNFN--INLFINLLEVFYVSIRLYNNHFVKINKGRQFDMGF 119 >UniRef50_Q40IS5 Cluster: Peptidase S49, SppA; n=5; canis group|Rep: Peptidase S49, SppA - Ehrlichia chaffeensis str. Sapulpa Length = 288 Score = 33.1 bits (72), Expect = 8.5 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +3 Query: 138 WRAFAYLAVVVALMKVLFVDIRILCNYRLNSYINNLEI 251 WR FA+ + V LM V ++DI + ++ N YI + I Sbjct: 18 WRVFAFFMIFVLLMLVNYIDISKISSFLDNEYIAKVNI 55 >UniRef50_A7AIE2 Cluster: Putative uncharacterized protein; n=2; Parabacteroides merdae ATCC 43184|Rep: Putative uncharacterized protein - Parabacteroides merdae ATCC 43184 Length = 651 Score = 33.1 bits (72), Expect = 8.5 Identities = 20/65 (30%), Positives = 33/65 (50%) Frame = +2 Query: 410 KIFVNHYK*VYKNFEVALRPYIPQLTIQQIFQENITTLVFETFDVFVFFSLFLEKTGQKP 589 KIF N YK + ++A YIP ++ +F +++T T D+ + L K+GQ P Sbjct: 308 KIFRNVYKPNEEYLKIATEKYIPP-KLRNMFIQDVTAEYMPTIDIRISLQESL-KSGQSP 365 Query: 590 VFYVY 604 +Y Sbjct: 366 FIAIY 370 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 677,213,588 Number of Sequences: 1657284 Number of extensions: 12832840 Number of successful extensions: 28962 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 27448 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28949 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 69554636255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -