BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0887 (808 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z83219-5|CAM35834.1| 390|Caenorhabditis elegans Hypothetical pr... 28 6.8 AC006777-6|AAK72307.1| 517|Caenorhabditis elegans Hypothetical ... 28 9.0 >Z83219-5|CAM35834.1| 390|Caenorhabditis elegans Hypothetical protein C31C9.8 protein. Length = 390 Score = 28.3 bits (60), Expect = 6.8 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +1 Query: 61 LHVCILFGFKKNTFTV*SRIYYCHIIGEPL 150 + CIL+ F+KN S +CH++G+ L Sbjct: 12 IRTCILYEFRKNLPIFESFKNFCHVLGDDL 41 >AC006777-6|AAK72307.1| 517|Caenorhabditis elegans Hypothetical protein Y46H3D.4 protein. Length = 517 Score = 27.9 bits (59), Expect = 9.0 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = +1 Query: 280 VYNLNFLCFFTSTLISTYMKMKMFNFFVSERIQNILNTDRF 402 ++ LNF F++ I + +K+F F SE + T +F Sbjct: 475 IFRLNFFILFSNNSILIFFILKVFVIFYSEHSFLVRRTSKF 515 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,652,120 Number of Sequences: 27780 Number of extensions: 340634 Number of successful extensions: 739 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 708 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 739 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1977346024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -