BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0886 (747 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z71178-13|CAF31498.1| 342|Caenorhabditis elegans Hypothetical p... 29 2.6 AC024801-2|AAK68512.1| 176|Caenorhabditis elegans Hypothetical ... 28 6.1 >Z71178-13|CAF31498.1| 342|Caenorhabditis elegans Hypothetical protein B0024.13b protein. Length = 342 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +2 Query: 248 KCISLTFIRIKKYMMISKFATNNISTNFCLFF 343 KC+ L F++ +KY ++ NN+S C F Sbjct: 119 KCLLLNFVKQQKYCILQMLYFNNVSNILCNHF 150 >AC024801-2|AAK68512.1| 176|Caenorhabditis elegans Hypothetical protein Y50D7A.5 protein. Length = 176 Score = 28.3 bits (60), Expect = 6.1 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +2 Query: 467 THKIRKFL*KNHLFLTTKVSLLFAVYFKKSDMSMSTE 577 T IR+F+ KN +F+ +V YF+ S + TE Sbjct: 19 TSSIRRFIVKNEVFMGRQVPEFCMDYFESSSAKLKTE 55 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,585,430 Number of Sequences: 27780 Number of extensions: 307184 Number of successful extensions: 562 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 551 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 562 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1766990064 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -