BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0877 (469 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 22 2.9 AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 22 3.8 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 22 3.8 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 3.8 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 3.8 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 21 5.0 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 21 8.7 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 22.2 bits (45), Expect = 2.9 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 59 MSQKVEKPVLSGQRIKT 109 M QK+EKPVLS T Sbjct: 314 MLQKLEKPVLSSSTTTT 330 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.8 bits (44), Expect = 3.8 Identities = 6/25 (24%), Positives = 17/25 (68%) Frame = +2 Query: 56 CMSQKVEKPVLSGQRIKTRKRDEKE 130 C++ +++ + +R +T++RD+ E Sbjct: 170 CLAMGMKREAVQEERQRTKERDQSE 194 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.8 bits (44), Expect = 3.8 Identities = 6/25 (24%), Positives = 17/25 (68%) Frame = +2 Query: 56 CMSQKVEKPVLSGQRIKTRKRDEKE 130 C++ +++ + +R +T++RD+ E Sbjct: 170 CLAMGMKREAVQEERQRTKERDQSE 194 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.8 bits (44), Expect = 3.8 Identities = 9/44 (20%), Positives = 20/44 (45%) Frame = +2 Query: 59 MSQKVEKPVLSGQRIKTRKRDEKEKYDPNGFRDALVQGLERAGG 190 + ++++P+ Q + ++E+Y + AL Q GG Sbjct: 1640 LGDRMQRPMKESQENQQNAETQRERYYATIHKVALQQAANTGGG 1683 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 3.8 Identities = 9/44 (20%), Positives = 20/44 (45%) Frame = +2 Query: 59 MSQKVEKPVLSGQRIKTRKRDEKEKYDPNGFRDALVQGLERAGG 190 + ++++P+ Q + ++E+Y + AL Q GG Sbjct: 1636 LGDRMQRPMKESQENQQNAETQRERYYATIHKVALQQAANTGGG 1679 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 21.4 bits (43), Expect = 5.0 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 61 ESEGRKTSIIGSTD 102 ESE R+ S +GST+ Sbjct: 371 ESENRRNSCLGSTE 384 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 20.6 bits (41), Expect = 8.7 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -3 Query: 95 DPIILVFLPSDSYNILILTGYVG 27 DP+ +V + Y ++ +TG VG Sbjct: 48 DPLYIVLPITVIYAVIFVTGLVG 70 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,305 Number of Sequences: 438 Number of extensions: 3099 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12559158 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -