BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0875 (731 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 24 4.2 AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleo... 24 4.2 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 24.2 bits (50), Expect = 4.2 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 561 PAPMTPLTPLSADPGILPQLQ 623 P PM P P A PG+ P +Q Sbjct: 225 PMPMRPQMPPGAVPGMQPGMQ 245 >AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleotidase protein. Length = 570 Score = 24.2 bits (50), Expect = 4.2 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +3 Query: 438 CTNSQLCNSATDDAASNSTKYDVSMIAAGN 527 CT L A D +NST V+ + AGN Sbjct: 371 CTLGDLIADAYADQYTNSTVQPVAFVQAGN 400 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 677,740 Number of Sequences: 2352 Number of extensions: 12194 Number of successful extensions: 25 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74844540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -