BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0875 (731 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 25 0.97 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 24 1.7 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 23 3.0 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 24.6 bits (51), Expect = 0.97 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -2 Query: 493 VEFEAASSVAELHSWL 446 +EF+ +SV ELHSW+ Sbjct: 80 MEFDDWTSVMELHSWM 95 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 23.8 bits (49), Expect = 1.7 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +3 Query: 597 DPGILPQLQNIVSTVNLD 650 +P I+P++QN T N D Sbjct: 640 EPPIMPRVQNATDTTNFD 657 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 23.0 bits (47), Expect = 3.0 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +2 Query: 323 NSFNSNSPRHNRHLPLWVRRQL*DLAQSWGLHRG 424 +SFN+ + + + +PL+V R L G RG Sbjct: 67 DSFNNQADKSEKRIPLYVCRVLHTTVWVAGAQRG 100 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,401 Number of Sequences: 438 Number of extensions: 3225 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22779405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -