BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0866 (755 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0387 + 23038490-23038662,23039246-23039303,23039471-230395... 39 0.005 04_04_0549 - 26179668-26181176 32 0.57 10_08_0086 - 14729240-14729494,14730107-14730307 31 1.3 06_01_0775 - 5795329-5795801,5796582-5796720,5796810-5797049,579... 30 2.3 07_03_1539 + 27567397-27568985,27569153-27569279,27569361-27569837 29 4.0 04_04_0550 - 26187347-26188828 29 5.3 03_06_0546 - 34646946-34647289,34647542-34647608 29 5.3 01_01_1011 - 8003080-8004216 28 9.2 >11_06_0387 + 23038490-23038662,23039246-23039303,23039471-23039551, 23039640-23039675,23039821-23040060,23040155-23040293, 23041417-23041889 Length = 399 Score = 38.7 bits (86), Expect = 0.005 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = +1 Query: 523 WDKSPHVQHYTHHPKEYLTALYAHLDASGLI 615 W SPHV HY HHP+EY A+ L + ++ Sbjct: 236 WQNSPHVGHYKHHPEEYRAAVTELLTKASML 266 >04_04_0549 - 26179668-26181176 Length = 502 Score = 31.9 bits (69), Expect = 0.57 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +1 Query: 7 VLSVSCTPWQLMWPMKGSQLVAGDVLKFMASN 102 V VSC PW ++W +KG+ + GDV +++ N Sbjct: 317 VALVSC-PWPVLWVIKGAGSLPGDVKEWLCEN 347 >10_08_0086 - 14729240-14729494,14730107-14730307 Length = 151 Score = 30.7 bits (66), Expect = 1.3 Identities = 14/60 (23%), Positives = 25/60 (41%) Frame = +1 Query: 157 GEVYVHVMNNRKMYQPVMDRIARRCGTLPRTSADHDRRAGRRLPEEPDHAEYSAGVYGIP 336 G ++ V+ + PV+ + + C LP + A +LP D + G G+P Sbjct: 69 GSLFHQVVAAADLLAPVLKQCSYHCAVLPNLCHNLPHHASTQLPRSGDGSSSGVGAKGVP 128 >06_01_0775 - 5795329-5795801,5796582-5796720,5796810-5797049, 5797278-5797313,5797421-5797501,5797937-5797994, 5799440-5799630 Length = 405 Score = 29.9 bits (64), Expect = 2.3 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +1 Query: 523 WDKSPHVQHYTHHPKEYLTAL 585 W SPHV HY H EY +A+ Sbjct: 242 WSDSPHVGHYMLHEAEYRSAV 262 >07_03_1539 + 27567397-27568985,27569153-27569279,27569361-27569837 Length = 730 Score = 29.1 bits (62), Expect = 4.0 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -2 Query: 79 RHRQLAVIPSWATLAATECTTP 14 RHR L +P W LA + TTP Sbjct: 89 RHRPLPAVPGWQLLAVADETTP 110 >04_04_0550 - 26187347-26188828 Length = 493 Score = 28.7 bits (61), Expect = 5.3 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = +1 Query: 16 VSCTPWQLMWPMKGSQLVAGDVLKFMASNENEQPLVVHGFS 138 VSC PW +W G+ + GDV ++ N + V H S Sbjct: 311 VSC-PWPTLWVFNGADTLPGDVRDWLRENTDADG-VAHAHS 349 >03_06_0546 - 34646946-34647289,34647542-34647608 Length = 136 Score = 28.7 bits (61), Expect = 5.3 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -1 Query: 548 CCTWGDLSQHFHVP*SPCC 492 CC G + FH+P PCC Sbjct: 70 CCYRGKMRDSFHLPEDPCC 88 >01_01_1011 - 8003080-8004216 Length = 378 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = -3 Query: 507 LIPMLHQESCTLRLLGSAPTGSLRESRNSAGAAHSGEW 394 L+PML + TLRL SA L + AG H W Sbjct: 188 LVPMLGTDHATLRLYWSATGLWLSKEVKYAGLGHPDSW 225 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,798,060 Number of Sequences: 37544 Number of extensions: 422207 Number of successful extensions: 1254 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1218 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1254 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2016060588 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -