BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0866 (755 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF100659-8|AAC68966.1| 688|Caenorhabditis elegans Hypothetical ... 30 2.0 Z35640-1|CAA84705.1| 307|Caenorhabditis elegans Hypothetical pr... 28 8.2 >AF100659-8|AAC68966.1| 688|Caenorhabditis elegans Hypothetical protein F58E2.3 protein. Length = 688 Score = 29.9 bits (64), Expect = 2.0 Identities = 18/42 (42%), Positives = 23/42 (54%), Gaps = 5/42 (11%) Frame = +2 Query: 326 MEYHMKTFYTSATSHYIRSSQL-----FHSPLCAAPALFLLS 436 +EYH K +TS TSH I QL F S +C + +FL S Sbjct: 43 LEYHQKGGHTSITSHEIYEKQLVRDSEFMSVVCKSLKVFLKS 84 >Z35640-1|CAA84705.1| 307|Caenorhabditis elegans Hypothetical protein F43D9.2 protein. Length = 307 Score = 27.9 bits (59), Expect = 8.2 Identities = 14/50 (28%), Positives = 26/50 (52%) Frame = -3 Query: 225 ARDAVHYRLVHLPIIHDVHVNFSPHVSSNREPVHHEGLLILVRSHEFENV 76 A +A H + L ++H + + HV S E E ++++++E ENV Sbjct: 251 ASEADHVESIFLTLLHKLQQSKPMHVQSQDERHQKEQERLILKANETENV 300 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,867,533 Number of Sequences: 27780 Number of extensions: 323722 Number of successful extensions: 922 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 902 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 922 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1798543458 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -