BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0865 (706 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 48 4e-07 EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. 27 0.57 AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. 25 2.3 AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcript... 25 2.3 CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein... 24 4.1 AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykin... 24 5.4 AY341161-1|AAR13725.1| 159|Anopheles gambiae CED6 protein. 23 7.1 AY341160-1|AAR13724.1| 159|Anopheles gambiae CED6 protein. 23 9.4 AY341159-1|AAR13723.1| 159|Anopheles gambiae CED6 protein. 23 9.4 AY341158-1|AAR13722.1| 159|Anopheles gambiae CED6 protein. 23 9.4 AY341157-1|AAR13721.1| 159|Anopheles gambiae CED6 protein. 23 9.4 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 47.6 bits (108), Expect = 4e-07 Identities = 25/63 (39%), Positives = 37/63 (58%), Gaps = 2/63 (3%) Frame = +3 Query: 498 KEFSGVAKTGSGKTLAYILPAIVH-INNQPPIR-RGDGPIALVLAPTRELAQQIQQVAAD 671 ++ A+TGSGKT A++LP I H ++ + + R P +++APTRELA QI Sbjct: 212 RDLMACAQTGSGKTAAFMLPMIHHLLDKEDSLELRTRNPYIVIVAPTRELAIQIHDEGRK 271 Query: 672 FGH 680 F H Sbjct: 272 FAH 274 Score = 43.2 bits (97), Expect = 8e-06 Identities = 19/56 (33%), Positives = 33/56 (58%) Frame = +1 Query: 346 EVTVSGDEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVA 513 +V VSG+ + ++ FE + + V V+ Y +PTPIQ PI ++G++L+A Sbjct: 161 QVRVSGENPPDHVESFERSGLREEVMTNVRKSSYTKPTPIQRYAIPIILNGRDLMA 216 >EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. Length = 452 Score = 27.1 bits (57), Expect = 0.57 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +3 Query: 99 TVVPNLEEATNSAIILLDLATVAIDLEDLEDLVGKKNSLE 218 T++ +L+E S + LDL ID +L +L +SLE Sbjct: 140 TMLRDLDEGCRSRVQYLDLKLNEIDTVNLAELAASSDSLE 179 >AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. Length = 471 Score = 25.0 bits (52), Expect = 2.3 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = -1 Query: 148 RRIIAEFVASSKFGTTVSTAIIPVTRHDYFSDLVEDVYLNYGFFLTQ 8 RR+ A+ A ++F ++ YF D+V DV L Y + Q Sbjct: 59 RRVRAKSKAMTEFLPLCDVLFNVISLAGYFCDVVFDVVLGYALYERQ 105 >AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcriptase protein. Length = 988 Score = 25.0 bits (52), Expect = 2.3 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 4/43 (9%) Frame = -3 Query: 278 KFLLKGWSKQNPNLGDACSDLQRILF----SHQILQILQIYCH 162 K +L+G S P GDA D++ +LF S +I +Q CH Sbjct: 929 KGILEG-SPNCPECGDAVEDVEHVLFHCPRSDRIRNEMQQRCH 970 >CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein protein. Length = 415 Score = 24.2 bits (50), Expect = 4.1 Identities = 16/70 (22%), Positives = 25/70 (35%) Frame = +1 Query: 220 SEHASPRLGFCLLQPFNKNFYDPHPTVLKRSPYEVEEYRNNHEVTVSGDEVHNPIQYFEE 399 SE + ++P Y+P P VL + V E + ++ + V EE Sbjct: 97 SEDVESSIPVSTIEPNLVEVYEPPPVVLIDTGNNVVEVNTDDQIVLEDGSVEGESNEQEE 156 Query: 400 ANFPDYVQQG 429 A Y G Sbjct: 157 AQIDVYHVDG 166 >AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykinin receptor protein. Length = 450 Score = 23.8 bits (49), Expect = 5.4 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +3 Query: 153 LATVAIDLEDLEDLVGKKNSLEVRTCVAQIGILFA 257 L +AID+ L+ +GKK +L V + +G + + Sbjct: 176 LMAIAIDMNPLKPRMGKKATLCVAASIWIVGTIIS 210 >AY341161-1|AAR13725.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.4 bits (48), Expect = 7.1 Identities = 14/27 (51%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +3 Query: 462 HSSSRLADSY-VWKEFSGVAKTGSGKT 539 H S AD V K FS +AKTG+G T Sbjct: 69 HKISYCADEKGVKKFFSFIAKTGTGAT 95 >AY341160-1|AAR13724.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.0 bits (47), Expect = 9.4 Identities = 14/27 (51%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +3 Query: 462 HSSSRLADSY-VWKEFSGVAKTGSGKT 539 H S AD V K FS +AKTG+G T Sbjct: 69 HKISYCADEKGVKKFFSFIAKTGTGVT 95 >AY341159-1|AAR13723.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.0 bits (47), Expect = 9.4 Identities = 14/27 (51%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +3 Query: 462 HSSSRLADSY-VWKEFSGVAKTGSGKT 539 H S AD V K FS +AKTG+G T Sbjct: 69 HKISYCADEKGVKKFFSFIAKTGTGVT 95 >AY341158-1|AAR13722.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.0 bits (47), Expect = 9.4 Identities = 14/27 (51%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +3 Query: 462 HSSSRLADSY-VWKEFSGVAKTGSGKT 539 H S AD V K FS +AKTG+G T Sbjct: 69 HKISYCADEKGVKKFFSFIAKTGTGVT 95 >AY341157-1|AAR13721.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.0 bits (47), Expect = 9.4 Identities = 14/27 (51%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +3 Query: 462 HSSSRLADSY-VWKEFSGVAKTGSGKT 539 H S AD V K FS +AKTG+G T Sbjct: 69 HKISYCADEKGVKKFFSFIAKTGTGVT 95 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 713,638 Number of Sequences: 2352 Number of extensions: 14849 Number of successful extensions: 42 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 41 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71922660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -