BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0858 (749 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U00036-4|AAK29850.1| 217|Caenorhabditis elegans Ribosomal prote... 82 4e-16 U88314-10|AAP68949.1| 344|Caenorhabditis elegans Hypothetical p... 28 8.1 >U00036-4|AAK29850.1| 217|Caenorhabditis elegans Ribosomal protein, large subunitprotein 6 protein. Length = 217 Score = 82.2 bits (194), Expect = 4e-16 Identities = 39/66 (59%), Positives = 48/66 (72%), Gaps = 1/66 (1%) Frame = +2 Query: 509 LAGRHAGKRVVLVGILP-SGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLGNFKLPKH 685 LAGRH GKRVV + LP SGLLLVTGP N PLRRI Q +VI TS ++++ K+P+H Sbjct: 80 LAGRHKGKRVVFLKQLPQSGLLLVTGPHKINGFPLRRIGQAFVIATSLKVNVSGVKIPEH 139 Query: 686 FNDDYF 703 ND+YF Sbjct: 140 INDEYF 145 >U88314-10|AAP68949.1| 344|Caenorhabditis elegans Hypothetical protein C46H11.10a protein. Length = 344 Score = 27.9 bits (59), Expect = 8.1 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -3 Query: 189 FLSHRTCRCGSRLGRRFRLCWSHHLFEGSTM 97 FL TCR S + RFR + HL EG + Sbjct: 41 FLQWSTCRALSEVNLRFRSHFKQHLKEGQAL 71 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,711,968 Number of Sequences: 27780 Number of extensions: 350163 Number of successful extensions: 860 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 821 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 859 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1777507862 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -