BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0856 (593 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0640 + 25744048-25745021,25745128-25745273,25747870-257479... 28 4.9 03_02_0285 - 7096088-7096506,7096817-7096982,7097114-7097296,709... 28 6.5 >11_06_0640 + 25744048-25745021,25745128-25745273,25747870-25747945, 25747996-25748230 Length = 476 Score = 28.3 bits (60), Expect = 4.9 Identities = 16/35 (45%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = +1 Query: 139 YLIASTLLITRHILRTDALYRRDGRI-TFIVQFTV 240 YL +T L+TRH+LR L DGR F+V F++ Sbjct: 243 YLFFATTLVTRHLLRGALL--GDGRFYVFLVVFSI 275 >03_02_0285 - 7096088-7096506,7096817-7096982,7097114-7097296, 7097529-7097768 Length = 335 Score = 27.9 bits (59), Expect = 6.5 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -3 Query: 237 GKLDNKGDPAVASVQGVRSQYVASDQ*SGCD 145 G + + GDPAVA+ + + Y A+ Q CD Sbjct: 276 GLVSSSGDPAVAATKALVQAYSANGQRFSCD 306 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,596,236 Number of Sequences: 37544 Number of extensions: 262041 Number of successful extensions: 580 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 565 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 580 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1411925004 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -