BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0856 (593 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024807-3|AAK84614.1| 252|Caenorhabditis elegans Hypothetical ... 29 2.5 AC006723-3|AAF59427.1| 881|Caenorhabditis elegans Hypothetical ... 27 7.6 >AC024807-3|AAK84614.1| 252|Caenorhabditis elegans Hypothetical protein Y53G8AL.3 protein. Length = 252 Score = 29.1 bits (62), Expect = 2.5 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +3 Query: 72 YLLNCFD*KDKEITKVPSRTTPVSYRIHSIDHS 170 + L+C D T+VP+ TTPVS S H+ Sbjct: 25 FQLSCLDTTSSSTTEVPATTTPVSLEFVSSAHT 57 >AC006723-3|AAF59427.1| 881|Caenorhabditis elegans Hypothetical protein Y19D10B.4 protein. Length = 881 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/45 (24%), Positives = 25/45 (55%) Frame = +3 Query: 177 IANGRLVPTRRPDHLYCPIYRELVFCL*TQTNR*SHNVYRAKIEI 311 + NGRL+P + ++ PI+++++ T+ +N + +EI Sbjct: 620 MTNGRLIPLGKTENSIFPIFKDMMTVTTLTTDNEQYNCHDTALEI 664 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,780,525 Number of Sequences: 27780 Number of extensions: 242027 Number of successful extensions: 569 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 562 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 569 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1258229602 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -