BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0856 (593 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 23 2.3 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 23 3.0 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 23 3.0 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 23 3.0 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 21 6.9 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 23.0 bits (47), Expect = 2.3 Identities = 7/24 (29%), Positives = 16/24 (66%) Frame = -2 Query: 139 TGVVRLGTLVISLSFQSKQLSKYN 68 TG+ + T +++ ++ SK + +YN Sbjct: 192 TGMNNIETYIVNTNYSSKNMREYN 215 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 22.6 bits (46), Expect = 3.0 Identities = 7/24 (29%), Positives = 16/24 (66%) Frame = -2 Query: 139 TGVVRLGTLVISLSFQSKQLSKYN 68 TG+ + T +++ ++ SK + +YN Sbjct: 192 TGMNNIETYIVNTNYSSKYMREYN 215 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 22.6 bits (46), Expect = 3.0 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +2 Query: 317 LTGKLKIIVFCGFNQIIMAAKSPTVSLKFREVIGVE 424 L G ++ G+ I S T+S KFR++I +E Sbjct: 534 LCGLSSMLCIPGYMIYIWFTTSGTISEKFRKLIRIE 569 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 22.6 bits (46), Expect = 3.0 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +2 Query: 317 LTGKLKIIVFCGFNQIIMAAKSPTVSLKFREVIGVE 424 L G ++ G+ I S T+S KFR++I +E Sbjct: 587 LCGLSSMLCIPGYMIYIWFTTSGTISEKFRKLIRIE 622 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 21.4 bits (43), Expect = 6.9 Identities = 6/13 (46%), Positives = 11/13 (84%) Frame = +3 Query: 120 PSRTTPVSYRIHS 158 P RT+P+ YR+++ Sbjct: 418 PDRTSPMEYRLYN 430 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,573 Number of Sequences: 438 Number of extensions: 2892 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17359926 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -