BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0854 (543 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 23 2.7 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 22 4.6 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 22 4.6 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 22 4.6 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 22 4.6 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 21 6.1 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 22.6 bits (46), Expect = 2.7 Identities = 15/42 (35%), Positives = 18/42 (42%) Frame = -1 Query: 177 CVTTEELKLLHFGL*KCHD*VVIADCFFDNETVGSVLATEDR 52 CV+ E L + L CH VV C + L TEDR Sbjct: 301 CVSGEHLSVSGGALNDCHAEVVARRCLCEYLYKQLELHTEDR 342 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 21.8 bits (44), Expect = 4.6 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +2 Query: 218 SCSQTIIALMRKSDEPCCEKQPSCAS 295 S QT I + K+DE K PS S Sbjct: 208 SYEQTAITYVWKNDEGTLRKSPSLTS 233 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 21.8 bits (44), Expect = 4.6 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +2 Query: 218 SCSQTIIALMRKSDEPCCEKQPSCAS 295 S QT I + K+DE K PS S Sbjct: 208 SYEQTAITYVWKNDEGTLRKSPSLTS 233 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 21.8 bits (44), Expect = 4.6 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +2 Query: 218 SCSQTIIALMRKSDEPCCEKQPSCAS 295 S QT I + K+DE K PS S Sbjct: 259 SYEQTAITYVWKNDEGTLRKSPSLTS 284 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 21.8 bits (44), Expect = 4.6 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +2 Query: 218 SCSQTIIALMRKSDEPCCEKQPSCAS 295 S QT I + K+DE K PS S Sbjct: 208 SYEQTAITYVWKNDEGTLRKSPSLTS 233 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 21.4 bits (43), Expect = 6.1 Identities = 13/44 (29%), Positives = 19/44 (43%) Frame = -3 Query: 517 WICATTLNSTARMPPRTMKVSSRWIGR*ASMKYGFKYTSNRLPV 386 W+ L+ TA + M R+ +KYG K T R+ V Sbjct: 117 WVSFDVLSCTASILNLCMISVDRFCAITKPLKYGVKRTPRRMIV 160 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,408 Number of Sequences: 438 Number of extensions: 2909 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15459066 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -