BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0850 (756 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1F12.02c |p23fy||translationally controlled tumor protein ho... 67 3e-12 SPCC1442.01 |ste6|SPCC1450.17|guanyl-nucleotide exchange factor ... 29 0.72 SPAC4F10.16c |||P-type ATPase |Schizosaccharomyces pombe|chr 1||... 27 3.8 SPCC74.09 |mug24||RNA-binding protein, rrm type|Schizosaccharomy... 27 3.8 SPAC821.09 |eng1||endo-1,3-beta-glucanase Eng1|Schizosaccharomyc... 26 6.7 >SPAC1F12.02c |p23fy||translationally controlled tumor protein homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 168 Score = 66.9 bits (156), Expect = 3e-12 Identities = 31/65 (47%), Positives = 46/65 (70%), Gaps = 1/65 (1%) Frame = +1 Query: 61 MKIYKDIITGDEMFSDTYKMKLVDEVIYEVTGRLVTRAQ-GDIQIEGFNPSAEEADEGTD 237 M +YKD+I+GDE+ SD Y +K VD+++YE ++VT Q GD+ I G NPSAE+A+E + Sbjct: 1 MLLYKDVISGDELVSDAYDLKEVDDIVYEADCQMVTVKQGGDVDI-GANPSAEDAEENAE 59 Query: 238 SAVES 252 E+ Sbjct: 60 EGTET 64 Score = 62.1 bits (144), Expect = 8e-11 Identities = 35/84 (41%), Positives = 47/84 (55%) Frame = +3 Query: 258 DIVLNHRLVETYAFGDKKSYTLYLKDYMXXXXXXXXXXXXDQVEVFKTNMNKVMKDILGR 437 ++V + RL T +F DKKSY Y+K YM ++V VF+ N +K IL Sbjct: 67 NLVYSFRLSPT-SF-DKKSYMSYIKGYMKAIKARLQESNPERVPVFEKNAIGFVKKILAN 124 Query: 438 FKELQFFTGESMDCDGMVAMMEYR 509 FK+ F+ GESMD D MV +M YR Sbjct: 125 FKDYDFYIGESMDPDAMVVLMNYR 148 >SPCC1442.01 |ste6|SPCC1450.17|guanyl-nucleotide exchange factor Ste6|Schizosaccharomyces pombe|chr 3|||Manual Length = 911 Score = 29.1 bits (62), Expect = 0.72 Identities = 16/33 (48%), Positives = 21/33 (63%) Frame = -1 Query: 615 ASLELLSYLLSNI*NFSSSRPCLKNIMIGICVP 517 AS ELL+ L NFS+ R CL+N ++ CVP Sbjct: 781 ASFELLNNLTEARKNFSNYRDCLENCVLP-CVP 812 >SPAC4F10.16c |||P-type ATPase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1367 Score = 26.6 bits (56), Expect = 3.8 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -2 Query: 98 ISSPVIMSL*IFILMDWRRLKII 30 ISSP I + IFILM+ RL +I Sbjct: 1220 ISSPTIFVINIFILMNQERLNLI 1242 >SPCC74.09 |mug24||RNA-binding protein, rrm type|Schizosaccharomyces pombe|chr 3|||Manual Length = 654 Score = 26.6 bits (56), Expect = 3.8 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -1 Query: 120 HFVSVREHLITSDNVLIDLHFDGLEAIKNNKNRKNGF 10 +F + + L T + LI + +E+IK KNR +GF Sbjct: 503 YFSHISDSLTTEELELILRQYGEIESIKYLKNRSSGF 539 >SPAC821.09 |eng1||endo-1,3-beta-glucanase Eng1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1016 Score = 25.8 bits (54), Expect = 6.7 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = +1 Query: 199 FNPSAEEADEGTDSAVESGLT*S*TTG*SKHTPSVTRNPTHCTSKT 336 +NPS D G V+S T S T T S+T PT ++ T Sbjct: 826 YNPSQYGCDNGALGPVQSSSTTSSITPTPTTTSSITPTPTTTSTTT 871 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,046,946 Number of Sequences: 5004 Number of extensions: 61995 Number of successful extensions: 145 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 135 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 145 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 361294920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -