BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0848 (744 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 24 1.5 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 23 2.0 EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 22 6.0 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 22 6.0 AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 21 7.9 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 21 7.9 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 23.8 bits (49), Expect = 1.5 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +3 Query: 69 KVGIIQHSLILDVFKMPVISNDQRQA 146 KVG HS ++V+ +P + + ++QA Sbjct: 496 KVGSADHSARINVYGLPFVRSMEKQA 521 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 23.4 bits (48), Expect = 2.0 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -2 Query: 605 IPFHSYENFKRHHNLAITANDCLCADN 525 +PF +EN KR +N+ + DN Sbjct: 336 VPFDLFENKKRKNNIKLYVRRVFIMDN 362 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 21.8 bits (44), Expect = 6.0 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = -2 Query: 302 VGFETTFFAACHPL*LKYVPTGLTVLNACLCRYF 201 + FE ++A C PL Y+ T CL +F Sbjct: 164 ISFER-YYAICKPLKAGYICTKTRASLICLLAWF 196 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 21.8 bits (44), Expect = 6.0 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = -2 Query: 302 VGFETTFFAACHPL*LKYVPTGLTVLNACLCRYF 201 + FE ++A C PL Y+ T CL +F Sbjct: 164 ISFER-YYAICKPLKAGYICTKTRASLICLLAWF 196 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 21.4 bits (43), Expect = 7.9 Identities = 8/20 (40%), Positives = 13/20 (65%), Gaps = 4/20 (20%) Frame = +2 Query: 23 CLVFKLHKNKCSS----KCQ 70 C++ K H+N+C + KCQ Sbjct: 82 CIIDKTHRNQCRACRLKKCQ 101 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 21.4 bits (43), Expect = 7.9 Identities = 8/20 (40%), Positives = 13/20 (65%), Gaps = 4/20 (20%) Frame = +2 Query: 23 CLVFKLHKNKCSS----KCQ 70 C++ K H+N+C + KCQ Sbjct: 82 CIIDKTHRNQCRACRLKKCQ 101 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,592 Number of Sequences: 336 Number of extensions: 3683 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19819879 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -