BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0848 (744 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0725 - 6480773-6481203,6481802-6482801 29 5.2 04_04_1257 - 32155935-32156526,32156655-32157067 28 9.0 >08_01_0725 - 6480773-6481203,6481802-6482801 Length = 476 Score = 28.7 bits (61), Expect = 5.2 Identities = 17/59 (28%), Positives = 26/59 (44%), Gaps = 1/59 (1%) Frame = -3 Query: 538 CALTTL*NNLSTRRSTWLRSGRRVIFGHFKTDPRLHRPGH-FYKPASALNHENRPFPNN 365 C L+ L + + T LR R+++ + D +H P SA+NH N F N Sbjct: 361 CQLSVLLTKTAEIQRTTLRLSRQLVSSNNNIDDIIHSTNAPLAPPNSAINHGNNTFSTN 419 >04_04_1257 - 32155935-32156526,32156655-32157067 Length = 334 Score = 27.9 bits (59), Expect = 9.0 Identities = 17/59 (28%), Positives = 26/59 (44%), Gaps = 1/59 (1%) Frame = -3 Query: 538 CALTTL*NNLSTRRSTWLRSGRRVIFGHFKTDPRLHRPGHFYKPA-SALNHENRPFPNN 365 C L+ L + + T LR R+++ + D +H P SA+NH N F N Sbjct: 219 CQLSVLLTKTAEIQRTTLRLSRQLVSSNSNIDDIIHNTNAPPAPPNSAINHSNNIFSTN 277 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,976,962 Number of Sequences: 37544 Number of extensions: 356632 Number of successful extensions: 610 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 601 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 610 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1968901276 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -