BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0848 (744 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL021572-1|CAA16516.2| 654|Caenorhabditis elegans Hypothetical ... 29 4.6 AF025469-4|AAG00032.1| 270|Caenorhabditis elegans Hypothetical ... 28 6.1 >AL021572-1|CAA16516.2| 654|Caenorhabditis elegans Hypothetical protein W06H3.1 protein. Length = 654 Score = 28.7 bits (61), Expect = 4.6 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +2 Query: 158 YMIEKKKTHKDCFYENIYKDTR*ELSTLLAHISARADDTLQR 283 + +E K H + YE+ K + +L T+LAH R D Q+ Sbjct: 291 FQMELKAVHPNLNYEDGMKIKKADLHTILAHAHLRIDQLSQK 332 >AF025469-4|AAG00032.1| 270|Caenorhabditis elegans Hypothetical protein W09B6.5 protein. Length = 270 Score = 28.3 bits (60), Expect = 6.1 Identities = 12/22 (54%), Positives = 16/22 (72%), Gaps = 3/22 (13%) Frame = -1 Query: 186 LCVFFFSIIYNKYMLA---SDH 130 LCV+FFS+ +N Y L+ SDH Sbjct: 159 LCVYFFSLAFNSYSLSLRLSDH 180 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,342,831 Number of Sequences: 27780 Number of extensions: 341119 Number of successful extensions: 750 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 722 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 750 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1756472266 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -