BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0848 (744 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 24 1.3 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 2.3 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 24.2 bits (50), Expect = 1.3 Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +2 Query: 158 YMIEKKKTHKDCFYENIYKDTR*E-LSTLLAHIS 256 Y+I K++ +D Y NI D R E + +A++S Sbjct: 295 YIIPKEQVKEDSLYTNIVVDIRNEDCGSAIAYVS 328 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +3 Query: 69 KVGIIQHSLILDVFKMPVISNDQRQA 146 KVG +HS L+V+ +P I + ++A Sbjct: 476 KVGSAEHSARLNVYGLPFIRHMDKKA 501 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 198,035 Number of Sequences: 438 Number of extensions: 4222 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23266665 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -