BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0844 (668 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39902| Best HMM Match : Glycolytic (HMM E-Value=1.2) 84 1e-16 SB_26182| Best HMM Match : Glycolytic (HMM E-Value=0) 81 1e-15 SB_29696| Best HMM Match : Herpes_US9 (HMM E-Value=0.56) 32 0.49 SB_21175| Best HMM Match : GLYCAM-1 (HMM E-Value=1) 31 0.64 SB_2772| Best HMM Match : DUF1279 (HMM E-Value=1.3) 31 0.64 SB_47658| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.85 SB_41373| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.85 SB_35962| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.85 SB_58746| Best HMM Match : RA (HMM E-Value=0.85) 31 1.1 SB_53284| Best HMM Match : DUF1279 (HMM E-Value=1.5) 30 1.5 SB_52973| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_38721| Best HMM Match : Methionine_synt (HMM E-Value=1.5) 30 1.5 SB_14512| Best HMM Match : IncA (HMM E-Value=0.12) 30 1.5 SB_7380| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_54449| Best HMM Match : bZIP_2 (HMM E-Value=1.2) 30 1.5 SB_33326| Best HMM Match : DUF1279 (HMM E-Value=1.4) 30 1.5 SB_31492| Best HMM Match : DUF1279 (HMM E-Value=0.38) 30 1.5 SB_59698| Best HMM Match : Flp_Fap (HMM E-Value=0.83) 30 2.0 SB_57351| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_56646| Best HMM Match : Phage_GP20 (HMM E-Value=1.7) 30 2.0 SB_56090| Best HMM Match : BenE (HMM E-Value=0.2) 30 2.0 SB_54541| Best HMM Match : bZIP_1 (HMM E-Value=1.9) 30 2.0 SB_52983| Best HMM Match : GntP_permease (HMM E-Value=1.2) 30 2.0 SB_50251| Best HMM Match : Transgly_assoc (HMM E-Value=4) 30 2.0 SB_45510| Best HMM Match : DUF1279 (HMM E-Value=1.2) 30 2.0 SB_43095| Best HMM Match : DUF1279 (HMM E-Value=0.52) 30 2.0 SB_42844| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_42714| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_40208| Best HMM Match : DUF1212 (HMM E-Value=2.3) 30 2.0 SB_39573| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_37465| Best HMM Match : UPF0075 (HMM E-Value=1.2) 30 2.0 SB_36761| Best HMM Match : DUF1279 (HMM E-Value=0.23) 30 2.0 SB_35830| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_35437| Best HMM Match : DUF1212 (HMM E-Value=1.5) 30 2.0 SB_35158| Best HMM Match : GLYCAM-1 (HMM E-Value=1.3) 30 2.0 SB_32773| Best HMM Match : DUF1279 (HMM E-Value=0.45) 30 2.0 SB_31573| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_30815| Best HMM Match : Sas10_Utp3 (HMM E-Value=1) 30 2.0 SB_28291| Best HMM Match : DUF1131 (HMM E-Value=2.3) 30 2.0 SB_27942| Best HMM Match : GLYCAM-1 (HMM E-Value=1.3) 30 2.0 SB_27018| Best HMM Match : DUF1279 (HMM E-Value=1.3) 30 2.0 SB_23872| Best HMM Match : DUF1279 (HMM E-Value=0.77) 30 2.0 SB_23744| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_23494| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_22332| Best HMM Match : bZIP_2 (HMM E-Value=0.99) 30 2.0 SB_21215| Best HMM Match : DUF1279 (HMM E-Value=0.54) 30 2.0 SB_19033| Best HMM Match : GLYCAM-1 (HMM E-Value=1.8) 30 2.0 SB_15806| Best HMM Match : GLYCAM-1 (HMM E-Value=1.3) 30 2.0 SB_15621| Best HMM Match : DUF1279 (HMM E-Value=1.7) 30 2.0 SB_13335| Best HMM Match : DUF1279 (HMM E-Value=0.43) 30 2.0 SB_11057| Best HMM Match : Cornichon (HMM E-Value=4.5e-07) 30 2.0 SB_4184| Best HMM Match : DUF1279 (HMM E-Value=0.45) 30 2.0 SB_3751| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_775| Best HMM Match : bZIP_2 (HMM E-Value=3) 30 2.0 SB_449| Best HMM Match : Adeno_PIX (HMM E-Value=0.8) 30 2.0 SB_58549| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_58514| Best HMM Match : DUF1279 (HMM E-Value=1.8) 30 2.0 SB_56962| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_53685| Best HMM Match : bZIP_2 (HMM E-Value=0.99) 30 2.0 SB_51765| Best HMM Match : CHASE3 (HMM E-Value=2.6) 30 2.0 SB_50868| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_48416| Best HMM Match : DUF1279 (HMM E-Value=1.7) 30 2.0 SB_41375| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_34046| Best HMM Match : DUF1279 (HMM E-Value=0.19) 30 2.0 SB_30740| Best HMM Match : DUF1279 (HMM E-Value=0.42) 30 2.0 SB_30246| Best HMM Match : IspA (HMM E-Value=0.39) 30 2.0 SB_29183| Best HMM Match : DUF1279 (HMM E-Value=0.89) 30 2.0 SB_25475| Best HMM Match : DUF1279 (HMM E-Value=0.63) 30 2.0 SB_24711| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_23011| Best HMM Match : Mo-nitro_C (HMM E-Value=1.4) 30 2.0 SB_19185| Best HMM Match : DUF1269 (HMM E-Value=0.28) 30 2.0 SB_19157| Best HMM Match : FLO_LFY (HMM E-Value=0.27) 30 2.0 SB_15367| Best HMM Match : DUF1212 (HMM E-Value=0.98) 30 2.0 SB_15118| Best HMM Match : IncA (HMM E-Value=0.44) 30 2.0 SB_13929| Best HMM Match : VKOR (HMM E-Value=0.65) 30 2.0 SB_10025| Best HMM Match : GLYCAM-1 (HMM E-Value=1.3) 30 2.0 SB_8165| Best HMM Match : DUF1279 (HMM E-Value=3.6) 30 2.0 SB_5649| Best HMM Match : DUF1212 (HMM E-Value=2.6) 30 2.0 SB_5508| Best HMM Match : bZIP_2 (HMM E-Value=3) 30 2.0 SB_4222| Best HMM Match : DUF1279 (HMM E-Value=1.8) 30 2.0 SB_1332| Best HMM Match : FeoB_N (HMM E-Value=0.94) 30 2.0 SB_999| Best HMM Match : DUF1279 (HMM E-Value=1.2) 30 2.0 SB_370| Best HMM Match : DUF1279 (HMM E-Value=0.35) 30 2.0 SB_58632| Best HMM Match : Flp_Fap (HMM E-Value=1.1) 29 2.6 SB_38193| Best HMM Match : DUF1279 (HMM E-Value=4.5) 29 2.6 SB_29565| Best HMM Match : DUF1279 (HMM E-Value=0.35) 29 2.6 SB_20149| Best HMM Match : DUF837 (HMM E-Value=0.65) 29 2.6 SB_58610| Best HMM Match : RVT_1 (HMM E-Value=0.061) 29 2.6 SB_29912| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00036) 29 2.6 SB_29337| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_15318| Best HMM Match : DUF1279 (HMM E-Value=0.78) 29 2.6 SB_42271| Best HMM Match : DUF229 (HMM E-Value=0) 29 3.4 SB_10929| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_7883| Best HMM Match : Adeno_PIX (HMM E-Value=1.2) 29 3.4 SB_472| Best HMM Match : Cas1p (HMM E-Value=0) 29 3.4 SB_52542| Best HMM Match : DUF1279 (HMM E-Value=0.96) 29 3.4 SB_46829| Best HMM Match : DUF1279 (HMM E-Value=0.49) 29 3.4 SB_42708| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_3290| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_48040| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_13542| Best HMM Match : GvpG (HMM E-Value=2) 29 4.5 SB_40932| Best HMM Match : GvpG (HMM E-Value=2) 29 4.5 SB_9257| Best HMM Match : RVT_1 (HMM E-Value=9.1e-32) 29 4.5 SB_40741| Best HMM Match : UreF (HMM E-Value=0.65) 28 6.0 SB_38995| Best HMM Match : Phage_Nu1 (HMM E-Value=1.3) 28 6.0 SB_10565| Best HMM Match : DUF1279 (HMM E-Value=1.3) 28 6.0 SB_24319| Best HMM Match : DUF1279 (HMM E-Value=0.58) 28 6.0 SB_19216| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_13006| Best HMM Match : DUF1279 (HMM E-Value=2.9) 28 6.0 SB_12834| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_33648| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_30655| Best HMM Match : DUF1279 (HMM E-Value=0.5) 28 7.9 SB_26622| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_13304| Best HMM Match : IncA (HMM E-Value=0.3) 28 7.9 SB_3093| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_59011| Best HMM Match : DUF1279 (HMM E-Value=0.51) 28 7.9 SB_38377| Best HMM Match : Transgly_assoc (HMM E-Value=4) 28 7.9 SB_37967| Best HMM Match : DUF1279 (HMM E-Value=0.28) 28 7.9 SB_26684| Best HMM Match : DUF1279 (HMM E-Value=0.52) 28 7.9 SB_19210| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_15904| Best HMM Match : Collagen (HMM E-Value=4.1e-11) 28 7.9 >SB_39902| Best HMM Match : Glycolytic (HMM E-Value=1.2) Length = 71 Score = 83.8 bits (198), Expect = 1e-16 Identities = 40/66 (60%), Positives = 50/66 (75%) Frame = +3 Query: 57 TFSYGRALQASVLRAWGGKTENILAGQQELIKRAKANGLAAVGKYVAGSIPSLAASKSNF 236 TFS+GRALQAS L+AW GK++ + AGQ+E +KRAKANG AA+GKY G SLA +S F Sbjct: 8 TFSFGRALQASALKAWSGKSDCVKAGQEEFLKRAKANGQAAMGKYAGGQ--SLAGDQSLF 65 Query: 237 VKSHAY 254 V +H Y Sbjct: 66 VANHQY 71 >SB_26182| Best HMM Match : Glycolytic (HMM E-Value=0) Length = 949 Score = 80.6 bits (190), Expect = 1e-15 Identities = 44/82 (53%), Positives = 55/82 (67%) Frame = +3 Query: 3 LGASERYQRCGPQEALGSTFSYGRALQASVLRAWGGKTENILAGQQELIKRAKANGLAAV 182 L A +YQ P + TFS+GRALQAS L+AW GK+ + AGQ+E +KRAKANG AA+ Sbjct: 282 LNAINQYQGKKPWKL---TFSFGRALQASALKAWSGKSGCVKAGQEEFLKRAKANGQAAM 338 Query: 183 GKYVAGSIPSLAASKSNFVKSH 248 GKY G SLA +S FV +H Sbjct: 339 GKYAGGQ--SLAGDQSLFVANH 358 Score = 27.9 bits (59), Expect = 7.9 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +1 Query: 1 ASVHLNAINAVDLKRPW 51 A++HLNAIN K+PW Sbjct: 278 ATIHLNAINQYQGKKPW 294 >SB_29696| Best HMM Match : Herpes_US9 (HMM E-Value=0.56) Length = 632 Score = 31.9 bits (69), Expect = 0.49 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = +3 Query: 126 LAGQQELIKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 LA + R NGL A+GK + +P L AS +NFV Sbjct: 240 LAKSLSSVARGVGNGLEAIGKKLFERLPGLVASIANFV 277 >SB_21175| Best HMM Match : GLYCAM-1 (HMM E-Value=1) Length = 280 Score = 31.5 bits (68), Expect = 0.64 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +3 Query: 144 LIKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 L+ R NGL A+GK + +P L S +NFV Sbjct: 212 LVARGVGNGLKAIGKKLGELLPGLVGSIANFV 243 >SB_2772| Best HMM Match : DUF1279 (HMM E-Value=1.3) Length = 179 Score = 31.5 bits (68), Expect = 0.64 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L AS +NFV Sbjct: 112 VARGVGNGLKAIGKKLGELLPGLVASIANFV 142 >SB_47658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 31.1 bits (67), Expect = 0.85 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV-KSHAYK 257 + R NGL A+GK + +P L S +NFV K+ A K Sbjct: 249 VARGVGNGLKAIGKKLGELLPGLVGSIANFVFKAEAVK 286 >SB_41373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 31.1 bits (67), Expect = 0.85 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV-KSHAYK 257 + R NGL A+GK + +P L S +NFV K+ A K Sbjct: 249 VARGVGNGLKAIGKKLGELLPGLVGSIANFVFKAEAVK 286 >SB_35962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 637 Score = 31.1 bits (67), Expect = 0.85 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 259 VARGVGNGLKAIGKKLGELLPGLVGSNANFV 289 >SB_58746| Best HMM Match : RA (HMM E-Value=0.85) Length = 820 Score = 30.7 bits (66), Expect = 1.1 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 201 VARGAGNGLKAIGKKLGELLPGLVGSVANFV 231 >SB_53284| Best HMM Match : DUF1279 (HMM E-Value=1.5) Length = 427 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFVKSHAY 254 + R NGL A+GK + +P L S +NFV A+ Sbjct: 231 VARGVGNGLKAIGKKLGELLPGLVGSIANFVFKAAH 266 >SB_52973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 973 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 259 VARGVGNGLKAIGKKLGERLPGLVGSIANFV 289 >SB_38721| Best HMM Match : Methionine_synt (HMM E-Value=1.5) Length = 329 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 230 VARGVGNGLKAIGKMLGELLPGLVGSIANFV 260 >SB_14512| Best HMM Match : IncA (HMM E-Value=0.12) Length = 642 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFVKSHAY 254 + R NGL A+GK + +P L S +NFV A+ Sbjct: 231 VPRGVGNGLKAIGKKLGELLPGLVGSIANFVFKAAH 266 >SB_7380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 112 VARGAGNGLKAIGKKLGELLPGLVGSIANFV 142 >SB_54449| Best HMM Match : bZIP_2 (HMM E-Value=1.2) Length = 258 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L +S +NFV Sbjct: 202 VARGVGNGLKAIGKKLGELLPGLVSSIANFV 232 >SB_33326| Best HMM Match : DUF1279 (HMM E-Value=1.4) Length = 326 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFVKSHAYK 257 + R NGL A+GK + +P L S +NFV A K Sbjct: 259 VARGVGNGLKAIGKKLGEILPGLVGSIANFVFKAAGK 295 >SB_31492| Best HMM Match : DUF1279 (HMM E-Value=0.38) Length = 327 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L +S +NFV Sbjct: 260 VARGVGNGLKAIGKKLGELLPGLVSSIANFV 290 >SB_59698| Best HMM Match : Flp_Fap (HMM E-Value=0.83) Length = 293 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 255 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 285 >SB_57351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 559 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 255 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 285 >SB_56646| Best HMM Match : Phage_GP20 (HMM E-Value=1.7) Length = 238 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 201 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 231 >SB_56090| Best HMM Match : BenE (HMM E-Value=0.2) Length = 520 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 211 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 241 >SB_54541| Best HMM Match : bZIP_1 (HMM E-Value=1.9) Length = 294 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 256 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 286 >SB_52983| Best HMM Match : GntP_permease (HMM E-Value=1.2) Length = 683 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 255 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 285 >SB_50251| Best HMM Match : Transgly_assoc (HMM E-Value=4) Length = 158 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 91 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 121 >SB_45510| Best HMM Match : DUF1279 (HMM E-Value=1.2) Length = 148 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 81 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 111 >SB_43095| Best HMM Match : DUF1279 (HMM E-Value=0.52) Length = 281 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 214 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 244 >SB_42844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 323 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 256 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 286 >SB_42714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 969 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 902 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 932 >SB_40208| Best HMM Match : DUF1212 (HMM E-Value=2.3) Length = 150 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 112 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 142 >SB_39573| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 322 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 255 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 285 >SB_37465| Best HMM Match : UPF0075 (HMM E-Value=1.2) Length = 336 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 255 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 285 >SB_36761| Best HMM Match : DUF1279 (HMM E-Value=0.23) Length = 244 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 104 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 134 >SB_35830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 577 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 244 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 274 >SB_35437| Best HMM Match : DUF1212 (HMM E-Value=1.5) Length = 184 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 128 VARGGGNGLKAIGKRLCELLPGLVGSIANFV 158 >SB_35158| Best HMM Match : GLYCAM-1 (HMM E-Value=1.3) Length = 322 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 255 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 285 >SB_32773| Best HMM Match : DUF1279 (HMM E-Value=0.45) Length = 231 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 64 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 94 >SB_31573| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 317 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 250 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 280 >SB_30815| Best HMM Match : Sas10_Utp3 (HMM E-Value=1) Length = 864 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 203 VARGVCNGLKAIGKKLGELLPGLVGSIANFV 233 >SB_28291| Best HMM Match : DUF1131 (HMM E-Value=2.3) Length = 421 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 354 VARGVGNGLQAIGKKLGELLPGLVGSIANFV 384 >SB_27942| Best HMM Match : GLYCAM-1 (HMM E-Value=1.3) Length = 322 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 255 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 285 >SB_27018| Best HMM Match : DUF1279 (HMM E-Value=1.3) Length = 334 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 232 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 262 >SB_23872| Best HMM Match : DUF1279 (HMM E-Value=0.77) Length = 268 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 201 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 231 >SB_23744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 189 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 219 >SB_23494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1013 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 112 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 142 >SB_22332| Best HMM Match : bZIP_2 (HMM E-Value=0.99) Length = 272 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 205 VARGVGNGLKAIGKKLGEFLPGLVGSIANFV 235 >SB_21215| Best HMM Match : DUF1279 (HMM E-Value=0.54) Length = 756 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 257 VARGVCNGLKAIGKKLGELLPGLVGSIANFV 287 >SB_19033| Best HMM Match : GLYCAM-1 (HMM E-Value=1.8) Length = 311 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 255 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 285 >SB_15806| Best HMM Match : GLYCAM-1 (HMM E-Value=1.3) Length = 322 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 255 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 285 >SB_15621| Best HMM Match : DUF1279 (HMM E-Value=1.7) Length = 323 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 256 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 286 >SB_13335| Best HMM Match : DUF1279 (HMM E-Value=0.43) Length = 319 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 252 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 282 >SB_11057| Best HMM Match : Cornichon (HMM E-Value=4.5e-07) Length = 340 Score = 29.9 bits (64), Expect = 2.0 Identities = 16/47 (34%), Positives = 23/47 (48%) Frame = +3 Query: 99 AWGGKTENILAGQQELIKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 A G +A L+ + NGL A+GK + +P L S +NFV Sbjct: 181 AIGFAVATTIAAIVTLLGKGVGNGLKAIGKKLGELLPGLVGSIANFV 227 >SB_4184| Best HMM Match : DUF1279 (HMM E-Value=0.45) Length = 287 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 114 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 144 >SB_3751| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 233 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 166 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 196 >SB_775| Best HMM Match : bZIP_2 (HMM E-Value=3) Length = 322 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 255 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 285 >SB_449| Best HMM Match : Adeno_PIX (HMM E-Value=0.8) Length = 217 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 157 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 187 >SB_58549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 259 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 289 >SB_58514| Best HMM Match : DUF1279 (HMM E-Value=1.8) Length = 319 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 252 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 282 >SB_56962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 89 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 119 >SB_53685| Best HMM Match : bZIP_2 (HMM E-Value=0.99) Length = 716 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 649 VARGVGNGLKAIGKKLGEFLPGLVGSIANFV 679 >SB_51765| Best HMM Match : CHASE3 (HMM E-Value=2.6) Length = 256 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 189 VDRGVGNGLKAIGKKLGELLPGLVGSIANFV 219 >SB_50868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 648 Score = 29.9 bits (64), Expect = 2.0 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFVKSHAYK 257 + R NGL A+GK + +P L S +NFV A K Sbjct: 213 VARGIGNGLKAIGKKLGELLPGLVGSIANFVFKAAGK 249 >SB_48416| Best HMM Match : DUF1279 (HMM E-Value=1.7) Length = 323 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 256 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 286 >SB_41375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 450 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 257 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 287 >SB_34046| Best HMM Match : DUF1279 (HMM E-Value=0.19) Length = 287 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 220 VARGVGNGLKAIGKKLGKLLPGLVGSIANFV 250 >SB_30740| Best HMM Match : DUF1279 (HMM E-Value=0.42) Length = 179 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 112 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 142 >SB_30246| Best HMM Match : IspA (HMM E-Value=0.39) Length = 1502 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 1320 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 1350 >SB_29183| Best HMM Match : DUF1279 (HMM E-Value=0.89) Length = 253 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 202 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 232 >SB_25475| Best HMM Match : DUF1279 (HMM E-Value=0.63) Length = 239 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 172 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 202 >SB_24711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 323 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 256 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 286 >SB_23011| Best HMM Match : Mo-nitro_C (HMM E-Value=1.4) Length = 420 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 213 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 243 >SB_19185| Best HMM Match : DUF1269 (HMM E-Value=0.28) Length = 407 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 201 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 231 >SB_19157| Best HMM Match : FLO_LFY (HMM E-Value=0.27) Length = 560 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 207 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 237 >SB_15367| Best HMM Match : DUF1212 (HMM E-Value=0.98) Length = 286 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 255 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 285 >SB_15118| Best HMM Match : IncA (HMM E-Value=0.44) Length = 835 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 255 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 285 >SB_13929| Best HMM Match : VKOR (HMM E-Value=0.65) Length = 498 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 255 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 285 >SB_10025| Best HMM Match : GLYCAM-1 (HMM E-Value=1.3) Length = 517 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 255 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 285 >SB_8165| Best HMM Match : DUF1279 (HMM E-Value=3.6) Length = 310 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 243 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 273 >SB_5649| Best HMM Match : DUF1212 (HMM E-Value=2.6) Length = 293 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 255 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 285 >SB_5508| Best HMM Match : bZIP_2 (HMM E-Value=3) Length = 322 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 255 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 285 >SB_4222| Best HMM Match : DUF1279 (HMM E-Value=1.8) Length = 179 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 112 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 142 >SB_1332| Best HMM Match : FeoB_N (HMM E-Value=0.94) Length = 348 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 255 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 285 >SB_999| Best HMM Match : DUF1279 (HMM E-Value=1.2) Length = 637 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 250 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 280 >SB_370| Best HMM Match : DUF1279 (HMM E-Value=0.35) Length = 322 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 255 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 285 >SB_58632| Best HMM Match : Flp_Fap (HMM E-Value=1.1) Length = 297 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 230 VAREVGNGLKAIGKKLGELLPGLVGSIANFV 260 >SB_38193| Best HMM Match : DUF1279 (HMM E-Value=4.5) Length = 351 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 143 VARGFGNGLKAIGKKLGELLPGLVGSIANFV 173 >SB_29565| Best HMM Match : DUF1279 (HMM E-Value=0.35) Length = 284 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 204 VARGFGNGLKAIGKKLGELLPGLVGSIANFV 234 >SB_20149| Best HMM Match : DUF837 (HMM E-Value=0.65) Length = 317 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 250 VARGAGNGLKAIGKKLGELLPVLVGSIANFV 280 >SB_58610| Best HMM Match : RVT_1 (HMM E-Value=0.061) Length = 1445 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 576 VAREVGNGLKAIGKKLGELLPGLVGSIANFV 606 >SB_29912| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00036) Length = 618 Score = 29.5 bits (63), Expect = 2.6 Identities = 16/61 (26%), Positives = 27/61 (44%) Frame = +1 Query: 88 RCSAPGEGRPRTFSPDSRS*SSVLRPTVSQQSANTLPALFLRWPLLNRTLSNLTLINEDE 267 +C APG R +PD + + +A+ LP +FL W L L + + + E Sbjct: 101 KCGAPGRFAARCRAPDDAAGAVTQGGRAEPVTASALPPMFLEW--LRLLLKEMHAVTDHE 158 Query: 268 L 270 + Sbjct: 159 V 159 >SB_29337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 283 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 238 VARGVGNGLKAIGKKLGELLPRLVGSIANFV 268 >SB_15318| Best HMM Match : DUF1279 (HMM E-Value=0.78) Length = 329 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 262 VAREVGNGLKAIGKKLGELLPGLVGSIANFV 292 >SB_42271| Best HMM Match : DUF229 (HMM E-Value=0) Length = 591 Score = 29.1 bits (62), Expect = 3.4 Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = -3 Query: 663 TTTLLEYKQMHLRDIITQ--MRYVILRAENYIRKYYATVQDKMH 538 TT ++ RD T RY + AENYIRK + + MH Sbjct: 339 TTAAFNFRLKGFRDPPTDHYSRYYWMEAENYIRKEFCSNNQAMH 382 >SB_10929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 636 Score = 29.1 bits (62), Expect = 3.4 Identities = 26/90 (28%), Positives = 44/90 (48%), Gaps = 5/90 (5%) Frame = +1 Query: 52 VRRSATGAPSRLRCSAPGE---GRPRTFSPDSRS*SSVLRPTVSQQSANTLPALF-LRWP 219 + S + P+ L S+P + G PR S +S S SS++RP SQ P + + Sbjct: 178 LENSTSFFPTPLATSSPLQVEAGHPRPPSLESLSRSSIMRPIGSQTMQGFSPKILENKID 237 Query: 220 LLNRTLSNLTL-INEDELTDSNIRLYLKTK 306 +L T ++L+ +N E+ N +Y K + Sbjct: 238 ILLATETHLSSHVNSCEILPQNFLVYRKDR 267 >SB_7883| Best HMM Match : Adeno_PIX (HMM E-Value=1.2) Length = 282 Score = 29.1 bits (62), Expect = 3.4 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL AVGK + +P L S S FV Sbjct: 243 VARGVGNGLKAVGKKLGELLPGLVGSISRFV 273 >SB_472| Best HMM Match : Cas1p (HMM E-Value=0) Length = 932 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + P L S +NFV Sbjct: 255 VARGVGNGLKAIGKKLGELFPGLVGSIANFV 285 >SB_52542| Best HMM Match : DUF1279 (HMM E-Value=0.96) Length = 179 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK ++ +P L S +NFV Sbjct: 112 VARGVGNGLKAIGKKLSELLPWLVGSIANFV 142 >SB_46829| Best HMM Match : DUF1279 (HMM E-Value=0.49) Length = 224 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + P L S +NFV Sbjct: 157 VARGVGNGLKAIGKKLGELFPGLVGSIANFV 187 >SB_42708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NFV Sbjct: 196 VARGVGNGLKAIGKKLDELLPGLVGSIANFV 226 >SB_3290| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 326 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +3 Query: 153 RAKANGLAAVGKYVAGSIPSLAASKSNFV 239 R+ NGL A+GK + +P L S +NFV Sbjct: 261 RSVGNGLKAIGKKLGVLLPGLVGSIANFV 289 >SB_48040| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S +NF+ Sbjct: 157 VARGVGNGLKAIGKKLGELLPGLVGSIANFL 187 >SB_13542| Best HMM Match : GvpG (HMM E-Value=2) Length = 264 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK +P L S +NFV Sbjct: 197 VARGVGNGLKAIGKKPGELLPGLVGSIANFV 227 >SB_40932| Best HMM Match : GvpG (HMM E-Value=2) Length = 438 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK +P L S +NFV Sbjct: 371 VARGVGNGLKAIGKKPGELLPGLVGSIANFV 401 >SB_9257| Best HMM Match : RVT_1 (HMM E-Value=9.1e-32) Length = 1086 Score = 28.7 bits (61), Expect = 4.5 Identities = 19/54 (35%), Positives = 27/54 (50%) Frame = +3 Query: 105 GGKTENILAGQQELIKRAKANGLAAVGKYVAGSIPSLAASKSNFVKSHAYK*GR 266 G +E L +E+++R ANGL A + PSL +S+F H Y GR Sbjct: 581 GRDSEEHLTNLEEVLRRLHANGLTAQREKCEFMQPSLKILRSHF---HIYLYGR 631 >SB_40741| Best HMM Match : UreF (HMM E-Value=0.65) Length = 266 Score = 28.3 bits (60), Expect = 6.0 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNF 236 + R NGL A+GK + +P L S +NF Sbjct: 201 VARGVGNGLKAIGKALGELLPRLVGSVANF 230 >SB_38995| Best HMM Match : Phage_Nu1 (HMM E-Value=1.3) Length = 226 Score = 28.3 bits (60), Expect = 6.0 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL +GK + +P L S +NFV Sbjct: 159 VARGVGNGLKTIGKKLGELLPGLVGSIANFV 189 >SB_10565| Best HMM Match : DUF1279 (HMM E-Value=1.3) Length = 177 Score = 28.3 bits (60), Expect = 6.0 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNF 236 + R NGL A+GK + +P L S +NF Sbjct: 112 VARGVGNGLKAIGKALGELLPRLVGSVANF 141 >SB_24319| Best HMM Match : DUF1279 (HMM E-Value=0.58) Length = 383 Score = 28.3 bits (60), Expect = 6.0 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK +P L S +NFV Sbjct: 213 VARGVGNGLNAIGKKPGELLPGLVGSIANFV 243 >SB_19216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 28.3 bits (60), Expect = 6.0 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK +P L S +NFV Sbjct: 213 VARGVGNGLNAIGKKPGELLPGLVGSIANFV 243 >SB_13006| Best HMM Match : DUF1279 (HMM E-Value=2.9) Length = 252 Score = 28.3 bits (60), Expect = 6.0 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNF 236 + R NGL A+GK + +P L S +NF Sbjct: 203 VARGVGNGLKAIGKKLGELLPGLVGSIANF 232 >SB_12834| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1261 Score = 28.3 bits (60), Expect = 6.0 Identities = 17/49 (34%), Positives = 29/49 (59%) Frame = +1 Query: 187 NTLPALFLRWPLLNRTLSNLTLINEDELTDSNIRLYLKTKQKKSFLIQF 333 NTL ++ ++P N T+ N+T+ L ++N+RL K + +S LI F Sbjct: 463 NTLLSVRFKFPFFNETVVNVTI--RKALFENNVRLE-KGESDRSSLIYF 508 >SB_33648| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 304 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L S ++FV Sbjct: 237 VARGVGNGLKAIGKKLGELLPGLVGSIASFV 267 >SB_30655| Best HMM Match : DUF1279 (HMM E-Value=0.5) Length = 692 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L +NF+ Sbjct: 244 VARGVGNGLKAIGKKLGNLLPGLVGGIANFM 274 >SB_26622| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 633 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L +NF+ Sbjct: 244 VARGVGNGLKAIGKKLGNLLPGLVGGIANFM 274 >SB_13304| Best HMM Match : IncA (HMM E-Value=0.3) Length = 611 Score = 27.9 bits (59), Expect = 7.9 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +3 Query: 153 RAKANGLAAVGKYVAGSIPSLAASKSNFV 239 R NGL A+GK + +P L S +NFV Sbjct: 113 RGVGNGLKAIGKKLGELLPWLVGSIANFV 141 >SB_3093| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P+L S +N V Sbjct: 253 VARGVGNGLKAIGKKLGELLPALVGSIANLV 283 >SB_59011| Best HMM Match : DUF1279 (HMM E-Value=0.51) Length = 235 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R NGL A+GK + +P L +NFV Sbjct: 168 VARGVGNGLKAIGKKLGELLPGLVGCIANFV 198 >SB_38377| Best HMM Match : Transgly_assoc (HMM E-Value=4) Length = 120 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +3 Query: 165 NGLAAVGKYVAGSIPSLAASKSNFV 239 NGL A+GK + +P L S +NFV Sbjct: 5 NGLKAIGKKLGELLPGLVGSIANFV 29 >SB_37967| Best HMM Match : DUF1279 (HMM E-Value=0.28) Length = 233 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNF 236 + R NGL A+GK + +P L S +NF Sbjct: 112 VARRVGNGLKAIGKKLGELLPGLVGSIANF 141 >SB_26684| Best HMM Match : DUF1279 (HMM E-Value=0.52) Length = 464 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 239 + R +GL A+GK + +P L S +NFV Sbjct: 214 VARGVGDGLKAIGKKLGELLPGLVGSIANFV 244 >SB_19210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 331 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 147 IKRAKANGLAAVGKYVAGSIPSLAASKSNF 236 + R NGL A+GK + +P L S +NF Sbjct: 112 VARRVGNGLKAIGKKLGELLPGLVGSIANF 141 >SB_15904| Best HMM Match : Collagen (HMM E-Value=4.1e-11) Length = 376 Score = 27.9 bits (59), Expect = 7.9 Identities = 15/60 (25%), Positives = 25/60 (41%) Frame = +1 Query: 112 RPRTFSPDSRS*SSVLRPTVSQQSANTLPALFLRWPLLNRTLSNLTLINEDELTDSNIRL 291 RP +P+S + S+ +RP T P + R L T + + + T +RL Sbjct: 117 RPTQATPESSTKSTTIRPEAENNVTTTKPGILENTTSPTRYLDEPTTLPQVDYTSQQLRL 176 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,800,961 Number of Sequences: 59808 Number of extensions: 365707 Number of successful extensions: 968 Number of sequences better than 10.0: 121 Number of HSP's better than 10.0 without gapping: 844 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 966 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1729817375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -