BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0843 (754 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0406 - 17688069-17690643,17691065-17691132 31 1.3 07_03_1568 - 27788314-27788619,27789125-27789294,27789868-277899... 31 1.3 03_06_0025 - 31110027-31110507,31111640-31111804,31113134-31113432 31 1.3 10_08_0883 + 21279913-21280235,21281066-21281327,21281998-212821... 29 3.0 04_04_0739 - 27693768-27694305,27694765-27694912,27694987-276951... 29 3.0 12_02_0929 - 24493168-24493458,24493545-24493643,24493768-244938... 29 4.0 11_06_0647 + 25870470-25870744,25870765-25871533 28 6.9 >10_08_0406 - 17688069-17690643,17691065-17691132 Length = 880 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +2 Query: 404 SIHGRESNNLARILQTYYETSHHPSLIWACVPMLCVEHI 520 ++H S N+ R++ TY+ +H P L W C ++ V + Sbjct: 554 TVHVFSSWNIVRMVCTYHRAAHRPWLRWLCFLVIRVRFL 592 >07_03_1568 - 27788314-27788619,27789125-27789294,27789868-27789979, 27790063-27790117,27790201-27790316,27790731-27790812, 27790974-27791228,27791326-27791454,27791539-27791747 Length = 477 Score = 30.7 bits (66), Expect = 1.3 Identities = 16/53 (30%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Frame = +2 Query: 260 DWTSRIVAKLSPYINVDSPSATVRQRHEDYLNEE--LSYCRGLGVPAIMISIH 412 DW SR++A Y+ +D P+AT D + E + R LG+ +++ H Sbjct: 203 DWKSRVIAVTDNYVVLDKPAATSVGGATDNIEESCVVFTSRALGLETPLMTTH 255 >03_06_0025 - 31110027-31110507,31111640-31111804,31113134-31113432 Length = 314 Score = 30.7 bits (66), Expect = 1.3 Identities = 18/75 (24%), Positives = 32/75 (42%) Frame = +2 Query: 308 DSPSATVRQRHEDYLNEELSYCRGLGVPAIMISIHGRESNNLARILQTYYETSHHPSLIW 487 D PS + + + S+ RG+G A+ IHG + LA + + P +++ Sbjct: 176 DDPSVVITTYEGQHCHHTASFQRGVGGAAVAAHIHGAAAVALAEQMSAFVSPPPQPHMLY 235 Query: 488 ACVPMLCVEHIENAL 532 +P L E A+ Sbjct: 236 G-LPRLHPPSSETAV 249 >10_08_0883 + 21279913-21280235,21281066-21281327,21281998-21282199, 21282289-21282436,21282541-21283084 Length = 492 Score = 29.5 bits (63), Expect = 3.0 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = +1 Query: 556 WNEPWYWWS--KFHERLDWDKRVGVVLELSADLP 651 W +PWYWWS L W K+ L +A++P Sbjct: 285 WFKPWYWWSWPILPLGLSWHKQRWDDLGYAAEMP 318 >04_04_0739 - 27693768-27694305,27694765-27694912,27694987-27695188, 27695802-27695864,27695865-27696120,27697811-27697953 Length = 449 Score = 29.5 bits (63), Expect = 3.0 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = +1 Query: 556 WNEPWYWWS--KFHERLDWDKRVGVVLELSADLP 651 W +PWYWWS L W ++ L S++LP Sbjct: 244 WFKPWYWWSWPVLPLGLSWHEQRRENLGYSSELP 277 >12_02_0929 - 24493168-24493458,24493545-24493643,24493768-24493872, 24494101-24494193,24494438-24494530,24494646-24494699, 24494816-24494917,24495058-24495132,24495245-24495418 Length = 361 Score = 29.1 bits (62), Expect = 4.0 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +1 Query: 169 RPLFTHVFVGNPQMPVKMVVLRGQIWF 249 R L T +FVGNP + M ++ WF Sbjct: 252 RDLITRIFVGNPASRITMPEIKNHPWF 278 >11_06_0647 + 25870470-25870744,25870765-25871533 Length = 347 Score = 28.3 bits (60), Expect = 6.9 Identities = 18/51 (35%), Positives = 25/51 (49%) Frame = +1 Query: 523 ECTEDDEEEKAWNEPWYWWSKFHERLDWDKRVGVVLELSADLPSQEVVKRW 675 E T+DD+EE E ++HE WD+R L +S LP E + W Sbjct: 240 ENTQDDKEESERQEEEKTTEEWHEWYKWDERSDRSL-VSIALPLIEAGEVW 289 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,992,710 Number of Sequences: 37544 Number of extensions: 454999 Number of successful extensions: 1115 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1093 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1113 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2004270760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -