BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0841 (684 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0510 - 21615724-21615909,21615992-21616075,21616164-216162... 29 3.4 01_06_0458 + 29531069-29531126,29531247-29531302,29531407-295315... 29 3.4 07_03_1695 - 28775525-28776098,28776586-28776693,28777129-28777448 28 7.9 02_01_0018 + 119890-120238,120331-120424,120518-121529 28 7.9 >06_03_0510 - 21615724-21615909,21615992-21616075,21616164-21616217, 21616324-21616371,21616529-21616611,21616963-21617113, 21617648-21617785,21617966-21618094,21618391-21618596, 21618734-21618845,21619145-21619204,21619331-21619429, 21619520-21619575,21620230-21620313,21621407-21621500 Length = 527 Score = 29.1 bits (62), Expect = 3.4 Identities = 22/68 (32%), Positives = 36/68 (52%) Frame = +3 Query: 45 KLPLKPSCYSEISHPTGTLTGSSRTDYPREHKWLI*VQQLHSRSRYKRPYRVPSLTHYLK 224 ++P+ +I+HPT LTG Y E + I +QLH+R Y +PSL+ +K Sbjct: 367 QIPILTMPNDDITHPTPDLTG-----YITEGQIYI-DRQLHNRQIYPPINVLPSLSRLMK 420 Query: 225 NAQKKRLT 248 +A + +T Sbjct: 421 SAIGEGMT 428 >01_06_0458 + 29531069-29531126,29531247-29531302,29531407-29531505, 29531989-29532048,29532285-29532396,29532459-29532694, 29533092-29533220,29533325-29533462,29534043-29534193, 29534394-29534476,29534658-29534705,29534828-29534881, 29534971-29535054,29535152-29535337 Length = 497 Score = 29.1 bits (62), Expect = 3.4 Identities = 22/68 (32%), Positives = 36/68 (52%) Frame = +3 Query: 45 KLPLKPSCYSEISHPTGTLTGSSRTDYPREHKWLI*VQQLHSRSRYKRPYRVPSLTHYLK 224 ++P+ +I+HPT LTG Y E + I +QLH+R Y +PSL+ +K Sbjct: 337 QIPILTMPNDDITHPTPDLTG-----YITEGQIYI-DRQLHNRQIYPPINVLPSLSRLMK 390 Query: 225 NAQKKRLT 248 +A + +T Sbjct: 391 SAIGEGMT 398 >07_03_1695 - 28775525-28776098,28776586-28776693,28777129-28777448 Length = 333 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +3 Query: 18 SSEKLAIAGKLPLKPSCYSEISHPTGTLTGSSRTDY 125 +SE A++ LPL S ++ P+ ++ GS+ DY Sbjct: 254 ASEAAALSSSLPLSAVVGSAVTTPSTSIVGSAPADY 289 >02_01_0018 + 119890-120238,120331-120424,120518-121529 Length = 484 Score = 27.9 bits (59), Expect = 7.9 Identities = 14/53 (26%), Positives = 28/53 (52%), Gaps = 2/53 (3%) Frame = -1 Query: 441 KKISFVYTMKRNVGNVK*HLC--LQSFGLLTVNVGYSLFALVSSLITLKPYAF 289 + +++ +K N+G K +C +Q LL V +GY++ A +S + + F Sbjct: 104 RNYTYMDAVKANLGGAKVKVCGCIQYLNLLGVAIGYTIAASISMMAIQRSNCF 156 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,890,762 Number of Sequences: 37544 Number of extensions: 294635 Number of successful extensions: 507 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 498 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 505 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1733104716 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -