BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0841 (684 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 23 2.1 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 23 2.7 AY526236-1|AAS20469.1| 85|Apis mellifera epoxide hydrolase pro... 21 8.3 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 23.4 bits (48), Expect = 2.1 Identities = 15/49 (30%), Positives = 20/49 (40%) Frame = -3 Query: 433 KFCLHYEAERGEREVTPLFTVFWSANRQCRL*SVCPC**PYNIKALCFC 287 ++ L+ E R P F FW + QCR + PYN FC Sbjct: 410 EYFLNLTVENNRRN--PWFVEFWEHHFQCRYPNASVT--PYNKNYTKFC 454 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 23.0 bits (47), Expect = 2.7 Identities = 8/25 (32%), Positives = 17/25 (68%) Frame = -3 Query: 667 IKKSLQIFKMQNKLSDMVEVKIDIS 593 + KSL++ + ++ D VE+K D++ Sbjct: 311 LDKSLEVNHISARVGDNVEIKCDVT 335 >AY526236-1|AAS20469.1| 85|Apis mellifera epoxide hydrolase protein. Length = 85 Score = 21.4 bits (43), Expect = 8.3 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -1 Query: 498 VIIVHNNYCCITQLHNFF 445 +I +HNN C L N F Sbjct: 21 IIGLHNNMCTSLNLSNLF 38 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,052 Number of Sequences: 438 Number of extensions: 3750 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20830365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -