BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0840 (745 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370046-1|ABD18607.1| 125|Anopheles gambiae putative secreted ... 28 0.35 AJ970250-1|CAI96722.1| 132|Anopheles gambiae putative reverse t... 27 0.81 AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant r... 27 0.81 AY750997-1|AAV31069.1| 153|Anopheles gambiae peritrophin-1 prot... 25 2.5 AY344823-1|AAR02434.1| 153|Anopheles gambiae peritrophin A prot... 25 2.5 AY344825-1|AAR02436.1| 153|Anopheles gambiae peritrophin A prot... 25 3.3 AY344824-1|AAR02435.1| 153|Anopheles gambiae peritrophin A prot... 25 3.3 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 24 4.3 AF030431-1|AAC39127.1| 153|Anopheles gambiae peritrophin 1 prot... 24 4.3 AY344828-1|AAR02439.1| 153|Anopheles gambiae peritrophin A prot... 23 7.5 AY344827-1|AAR02438.1| 153|Anopheles gambiae peritrophin A prot... 23 7.5 AY344826-1|AAR02437.1| 153|Anopheles gambiae peritrophin A prot... 23 7.5 AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 23 7.5 AY062201-1|AAL58562.1| 151|Anopheles gambiae cytochrome P450 CY... 23 7.5 AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein ... 23 10.0 AY187040-1|AAO39754.1| 211|Anopheles gambiae putative antennal ... 23 10.0 >DQ370046-1|ABD18607.1| 125|Anopheles gambiae putative secreted polypeptide protein. Length = 125 Score = 27.9 bits (59), Expect = 0.35 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 169 RCTAPCTSLSREETLEDCVEKCDSVLYSAVGGV 267 +C PC L+ T+ DC +C + Y A G V Sbjct: 62 KCCGPCYQLNCYGTVLDCAGRCYAECYCASGFV 94 >AJ970250-1|CAI96722.1| 132|Anopheles gambiae putative reverse transcriptase protein. Length = 132 Score = 26.6 bits (56), Expect = 0.81 Identities = 18/73 (24%), Positives = 31/73 (42%), Gaps = 1/73 (1%) Frame = +1 Query: 283 FLFKAMWRTSIFAIFLYLCSGLGITAGAHRLWAH-KSYKARLPLRILLTIFNTIAFQDAV 459 F+ K T++ Y S + A ++ KS LP ILL N + F ++ Sbjct: 38 FVPKKSTTTNLVEFVTYYTSQIDAGAQVDAIYTDLKSAFDSLPHAILLAKLNKVRFPCSL 97 Query: 460 VDWARDHRMHHKY 498 V W + + ++ Y Sbjct: 98 VQWLKSYLINRTY 110 >AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant receptor Or3 protein. Length = 411 Score = 26.6 bits (56), Expect = 0.81 Identities = 20/70 (28%), Positives = 33/70 (47%) Frame = +3 Query: 240 CSLFCCRWCLWRVLVPFQSHVEDFYIRHIFVLVFGIGYHSWRAQTLGTQVL*SSAATENI 419 C++ C L+ + F S V + ++ I V V GY + L T+VL S I Sbjct: 293 CTMIWCSLILYIAVTGFSSTVANVCVQIILVTVETYGY-GYFGTDLTTEVLWSYGVALAI 351 Query: 420 THHIQYYRFS 449 + ++Y+FS Sbjct: 352 -YDSEWYKFS 360 >AY750997-1|AAV31069.1| 153|Anopheles gambiae peritrophin-1 protein. Length = 153 Score = 25.0 bits (52), Expect = 2.5 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -3 Query: 389 DLCAQSLCAPAVIPNPEHKYKNMAN 315 D AQ+ CAP V PN E K N Sbjct: 70 DYPAQAQCAPGVTPNTEPASKPSPN 94 >AY344823-1|AAR02434.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 25.0 bits (52), Expect = 2.5 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -3 Query: 389 DLCAQSLCAPAVIPNPEHKYKNMAN 315 D AQ+ CAP V PN E K N Sbjct: 70 DYPAQAQCAPGVTPNTEPASKPSPN 94 >AY344825-1|AAR02436.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 24.6 bits (51), Expect = 3.3 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -3 Query: 389 DLCAQSLCAPAVIPNPEHKYKNMAN 315 D AQ+ CAP V PN E K N Sbjct: 70 DYPAQAQCAPGVTPNTEPAPKPSPN 94 >AY344824-1|AAR02435.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 24.6 bits (51), Expect = 3.3 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -3 Query: 389 DLCAQSLCAPAVIPNPEHKYKNMAN 315 D AQ+ CAP V PN E K N Sbjct: 70 DYPAQAQCAPGVTPNTEPAPKPSPN 94 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 24.2 bits (50), Expect = 4.3 Identities = 16/73 (21%), Positives = 29/73 (39%), Gaps = 1/73 (1%) Frame = +1 Query: 283 FLFKAMWRTSIFAIFLYLCSGLGITAGAHRLWAH-KSYKARLPLRILLTIFNTIAFQDAV 459 F+ K T++ Y S + A ++ K+ LP ILL + + + Sbjct: 653 FVPKKSTTTNLVEFVTYCTSQIDAGAQVDAIYTDLKAAFDSLPHAILLAKLDKLGIPSPL 712 Query: 460 VDWARDHRMHHKY 498 V W + + +H Y Sbjct: 713 VQWLKSYLIHRTY 725 >AF030431-1|AAC39127.1| 153|Anopheles gambiae peritrophin 1 protein. Length = 153 Score = 24.2 bits (50), Expect = 4.3 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -3 Query: 389 DLCAQSLCAPAVIPNPE 339 D AQ+ CAP V PN E Sbjct: 70 DYPAQAQCAPGVTPNTE 86 >AY344828-1|AAR02439.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 23.4 bits (48), Expect = 7.5 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -3 Query: 389 DLCAQSLCAPAVIPNPEHKYKNMAN 315 D +Q+ CAP V PN E K N Sbjct: 70 DYPSQAQCAPGVTPNTEPAPKPSPN 94 >AY344827-1|AAR02438.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 23.4 bits (48), Expect = 7.5 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -3 Query: 389 DLCAQSLCAPAVIPNPEHKYKNMAN 315 D +Q+ CAP V PN E K N Sbjct: 70 DYPSQAQCAPGVTPNTEPAPKPSPN 94 >AY344826-1|AAR02437.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 23.4 bits (48), Expect = 7.5 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -3 Query: 389 DLCAQSLCAPAVIPNPEHKYKNMAN 315 D +Q+ CAP V PN E K N Sbjct: 70 DYPSQAQCAPGVTPNTEPAPKPSPN 94 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 23.4 bits (48), Expect = 7.5 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 553 LAGCC*GSIPKSKP 594 L GCC G+ PK +P Sbjct: 1066 LVGCCIGAKPKQQP 1079 >AY062201-1|AAL58562.1| 151|Anopheles gambiae cytochrome P450 CYP4D22 protein. Length = 151 Score = 23.4 bits (48), Expect = 7.5 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +3 Query: 561 LLLRKHPEIKAKGHTVDVNDLRNDP 635 LLL +HPE++ + + V + NDP Sbjct: 22 LLLARHPEVQERVYREVVAIVGNDP 46 >AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein protein. Length = 699 Score = 23.0 bits (47), Expect = 10.0 Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 5/32 (15%) Frame = +2 Query: 221 VWRNVILFFILL-----SVVFMEGTCSFSKPC 301 VW I F+ + +V+F GT SF+ PC Sbjct: 538 VWDRAIAAFMKMPQFFQNVIFYFGTASFAIPC 569 >AY187040-1|AAO39754.1| 211|Anopheles gambiae putative antennal carrier protein A5 protein. Length = 211 Score = 23.0 bits (47), Expect = 10.0 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +2 Query: 506 PCGPPQRNPRILLFPHWLV 562 P P + NP + + HWLV Sbjct: 95 PDAPSRSNPEMRSWKHWLV 113 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 911,522 Number of Sequences: 2352 Number of extensions: 21603 Number of successful extensions: 57 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 56 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 57 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76507752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -