BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0839 (750 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0051 + 445035-445303,445380-445590,445737-445930,446151-44... 30 1.7 03_01_0092 - 731069-731434,731569-733080 29 3.0 04_01_0034 - 401208-402923 29 3.9 02_04_0532 + 23711530-23711755,23712984-23713093,23713204-237152... 29 3.9 11_01_0340 + 2534998-2535660 29 5.2 11_01_0044 + 340486-340854,341855-341911,343100-343974,344065-34... 29 5.2 05_01_0266 - 2040555-2040722,2041248-2041349,2041461-2041958,204... 29 5.2 >03_01_0051 + 445035-445303,445380-445590,445737-445930,446151-446228, 447049-447141,448495-448525,448729-449058 Length = 401 Score = 30.3 bits (65), Expect = 1.7 Identities = 15/48 (31%), Positives = 21/48 (43%) Frame = -3 Query: 253 STTSHMTHSRSYSYATSRGSHLPE*RGLLRLSYCRSRGRWSRTSWYIT 110 S +H+ S Y Y R H G L + SR R +R W++T Sbjct: 184 SKPAHILSSLCYPYVQLRQKHFAHQSGQALLRHVASRSRDTRFPWFVT 231 >03_01_0092 - 731069-731434,731569-733080 Length = 625 Score = 29.5 bits (63), Expect = 3.0 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = -2 Query: 278 PPPLNIPVEHYQPHDPQPILQLRHQPWQPSARIARAA 168 PPP+ + H P PQP LQ + + + RAA Sbjct: 260 PPPIQVQPHHIMPMTPQPQLQPPQPQSKEANTVVRAA 296 >04_01_0034 - 401208-402923 Length = 571 Score = 29.1 bits (62), Expect = 3.9 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = -2 Query: 275 PPLNIPVEHYQPHDPQPILQLRHQPWQPSARIARA 171 PP+ P+ QPH P+ LQ R P P + RA Sbjct: 283 PPMRAPLAEQQPHAPRLPLQPRPAPPPPPPQQQRA 317 >02_04_0532 + 23711530-23711755,23712984-23713093,23713204-23715298, 23716092-23716153,23716236-23716277,23716614-23716673, 23716873-23717010,23717333-23717374,23717452-23717574 Length = 965 Score = 29.1 bits (62), Expect = 3.9 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 370 WEIKQFLECAQQQHDLSLCDGFNEALRQ 453 W +KQFL+C Q+H +L + A+R+ Sbjct: 408 WILKQFLDCMYQKHPRALITDGDNAMRR 435 >11_01_0340 + 2534998-2535660 Length = 220 Score = 28.7 bits (61), Expect = 5.2 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 3/50 (6%) Frame = +1 Query: 67 KPSTSASKESCSPAK*C-TSSCGSIDPGY--DSSSTSAALAIRADGCHGW 207 KP++S+S S S ++C +PG SSS+S RAD C W Sbjct: 57 KPTSSSSSSSSSTGSASRAAACERKEPGSPASSSSSSGGKPGRADSCERW 106 >11_01_0044 + 340486-340854,341855-341911,343100-343974,344065-344398, 345553-345645,345913-346062 Length = 625 Score = 28.7 bits (61), Expect = 5.2 Identities = 14/31 (45%), Positives = 17/31 (54%), Gaps = 4/31 (12%) Frame = -2 Query: 284 LLPPPLNIPVE----HYQPHDPQPILQLRHQ 204 LL PL IP H HDP+P +QL H+ Sbjct: 284 LLALPLIIPASSSCSHVDTHDPEPTVQLNHE 314 >05_01_0266 - 2040555-2040722,2041248-2041349,2041461-2041958, 2042372-2042479,2042559-2042753 Length = 356 Score = 28.7 bits (61), Expect = 5.2 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +2 Query: 281 AASQPSNSKQLLQLKPTINTRDSRLKDHAR 370 AAS S Q L L +N +DS LK+H R Sbjct: 136 AASAKSAQSQCLSLLKELNEKDSSLKEHER 165 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,336,129 Number of Sequences: 37544 Number of extensions: 344280 Number of successful extensions: 888 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 862 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 888 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1992480932 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -