BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0836 (744 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 23 2.6 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 23 2.6 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 23 3.4 AF263515-1|AAF74207.1| 126|Tribolium castaneum cytochrome P450 ... 22 4.5 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 23.0 bits (47), Expect = 2.6 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 382 ETLGRIINVIGEPIDERGPIPTDKTAAIHAEAPEFVDMS 498 +TLG N I EP+ + T K ++ A AP D++ Sbjct: 380 QTLGGSSNEIVEPVPQPVEEVTQKPSSTKAPAPPSRDLT 418 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 23.0 bits (47), Expect = 2.6 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 534 RLLYQLRESLLHRHVDKLWSFS 469 R LY+L + RH KLW+F+ Sbjct: 402 RTLYKLPPNYEIRHKFKLWNFN 423 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 22.6 bits (46), Expect = 3.4 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +1 Query: 529 KSSICSLLMPKEERLGCLAELVWAKLY*LWN*STMLP 639 + S+ +LL E + C++E VW+KL N LP Sbjct: 97 QQSVTALLDTGSE-VSCISEEVWSKLIETGNKPPTLP 132 >AF263515-1|AAF74207.1| 126|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 126 Score = 22.2 bits (45), Expect = 4.5 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -3 Query: 280 HPNVGLPQVEAGRSILHLKGI*NRRQVIFELHIY 179 +P+V E G ++ G R+ I +LHIY Sbjct: 59 YPSVHYISRELGEDMVTTTGYKLRKGTILQLHIY 92 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,999 Number of Sequences: 336 Number of extensions: 4255 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19819879 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -