BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0834 (660 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein p... 24 1.3 AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 21 9.0 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 21 9.0 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 21 9.0 AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein p... 21 9.0 AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein p... 21 9.0 >AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein protein. Length = 287 Score = 23.8 bits (49), Expect = 1.3 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -1 Query: 585 PGMPCSIIMHHLVQGQSV 532 P SI+MHHLV QS+ Sbjct: 251 PAPTSSIMMHHLVNPQSL 268 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 21.0 bits (42), Expect = 9.0 Identities = 12/50 (24%), Positives = 20/50 (40%) Frame = -1 Query: 633 FHYPHVVDLRASQGYFPGMPCSIIMHHLVQGQSVPLLLPKQLLPYVNVRF 484 +HY S+ P P + HH Q P++ + L Y N+ + Sbjct: 42 YHYEDPYGYTGSEET-PPSPQEVYYHHQTIPQDNPIINTETGLSYTNLDY 90 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +1 Query: 361 VLGPPGAGKTT 393 +LG GAGKTT Sbjct: 109 ILGSSGAGKTT 119 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +1 Query: 361 VLGPPGAGKTT 393 +LG GAGKTT Sbjct: 109 ILGSSGAGKTT 119 >AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein protein. Length = 210 Score = 21.0 bits (42), Expect = 9.0 Identities = 12/50 (24%), Positives = 20/50 (40%) Frame = -1 Query: 633 FHYPHVVDLRASQGYFPGMPCSIIMHHLVQGQSVPLLLPKQLLPYVNVRF 484 +HY S+ P P + HH Q P++ + L Y N+ + Sbjct: 42 YHYEDPYGYTGSEET-PPSPQEVYYHHQTIPQDNPIINTETGLSYTNLDY 90 >AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein protein. Length = 253 Score = 21.0 bits (42), Expect = 9.0 Identities = 12/50 (24%), Positives = 20/50 (40%) Frame = -1 Query: 633 FHYPHVVDLRASQGYFPGMPCSIIMHHLVQGQSVPLLLPKQLLPYVNVRF 484 +HY S+ P P + HH Q P++ + L Y N+ + Sbjct: 42 YHYEDPYGYTGSEET-PPSPQEVYYHHQTIPQDNPIINTETGLSYTNLDY 90 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,078 Number of Sequences: 336 Number of extensions: 3536 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17073220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -