BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0832 (730 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 4.4 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 21 7.7 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.2 bits (45), Expect = 4.4 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +2 Query: 254 WIWDVRTGKCLKPLPAHSDPVSAVHFNRDGSLIVSSS 364 W W R G K LP+ DP H N +++ SSS Sbjct: 2330 WAW-YRQGDG-KYLPSDIDPSLCTHINYGFAVLDSSS 2364 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 21.4 bits (43), Expect = 7.7 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = +1 Query: 439 SCFVC*ILTEWKIYIGGDVRQHTQLWDYSRGKC 537 +C C +TE+K ++ +R H + KC Sbjct: 232 TCPKCPFITEYKHHLEYHLRNHAGSKPFQCNKC 264 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 190,495 Number of Sequences: 336 Number of extensions: 4210 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19467635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -