BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0826 (738 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0710 + 19660895-19661004,19661571-19661682,19661808-196618... 37 0.015 04_03_0711 + 18945012-18945692,18945790-18946845,18946863-18947066 35 0.078 07_01_0516 - 3850252-3852870 32 0.55 10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223,996... 31 0.72 09_02_0603 - 11150739-11150746,11150791-11151340 31 0.72 01_07_0021 - 40533864-40534583,40534779-40534814,40534909-405350... 31 0.95 08_02_0672 - 19904353-19904839,19905646-19905704,19906137-199063... 31 1.3 01_07_0081 - 40959279-40959375,40959463-40959589,40960138-409603... 31 1.3 03_04_0025 - 16557328-16557851,16558000-16558123,16558518-165586... 30 1.7 05_01_0142 - 940421-940701,941262-941574 29 2.9 03_01_0081 + 645214-645228,645791-645856,645973-646142,646265-64... 29 2.9 01_06_0319 - 28441082-28441102,28441630-28441701,28442568-284426... 29 2.9 06_03_1310 + 29238644-29240260 29 3.9 10_01_0172 - 1928648-1930751,1932019-1932243,1933709-1934676 29 5.1 09_04_0755 - 19948942-19949088,19949249-19949396,19949512-199496... 29 5.1 09_02_0543 + 10427321-10428315,10428440-10429154 29 5.1 09_02_0369 - 8012470-8013120 29 5.1 12_02_0811 - 23370455-23370472,23372279-23372538,23372645-233727... 28 6.7 10_08_0936 - 21679002-21679800,21679893-21680116,21681174-216813... 28 6.7 04_01_0069 - 697811-697876,697956-698166,698265-698359,698448-69... 28 6.7 02_05_1276 + 35397948-35398298,35398937-35401738,35402085-354023... 28 6.7 11_06_0671 + 26099292-26099491,26099589-26099622,26104787-261048... 28 8.9 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 28 8.9 05_03_0418 + 13700855-13700942,13701602-13701728,13701845-137019... 28 8.9 04_01_0162 + 1845295-1846317,1846430-1846565,1848436-1848626,184... 28 8.9 03_01_0515 - 3864796-3865425 28 8.9 02_05_0686 - 30900748-30902167,30903442-30904742 28 8.9 01_06_0347 + 28592552-28593502 28 8.9 >09_04_0710 + 19660895-19661004,19661571-19661682,19661808-19661879, 19661964-19662184,19662272-19662377 Length = 206 Score = 37.1 bits (82), Expect = 0.015 Identities = 23/76 (30%), Positives = 32/76 (42%), Gaps = 4/76 (5%) Frame = +1 Query: 247 GTEYLTTHRMIYNSKKNTDAMRSFSFPFIALQDVTVEQPMFSANCIKGKVR----AQPNG 414 GT YL+ RM++ + K +F P + + QP+F N I G V N Sbjct: 47 GTIYLSNIRMVFVASKPVGNFFAFDMPLLYVHGEKFNQPIFHCNNISGFVEPVVPENQNR 106 Query: 415 NFIGEVKFKLTFKSGG 462 FK+ FK GG Sbjct: 107 ALYSTHTFKILFKEGG 122 >04_03_0711 + 18945012-18945692,18945790-18946845,18946863-18947066 Length = 646 Score = 34.7 bits (76), Expect = 0.078 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = +3 Query: 624 PPYSAFPDQPPPNSVFVSNTPPPYPG 701 PPY+++P PP +S++ N PPP PG Sbjct: 440 PPYASYPPPPPGSSMY--NPPPPAPG 463 >07_01_0516 - 3850252-3852870 Length = 872 Score = 31.9 bits (69), Expect = 0.55 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +3 Query: 624 PPYSAFPDQPPPNSVFVSNTPPPYPGVTGASYP 722 PP P QPPP S + PPP P G S P Sbjct: 10 PPPRLLPPQPPPTSRPLPPPPPPPPPAHGPSPP 42 >10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223, 9969333-9970645 Length = 849 Score = 31.5 bits (68), Expect = 0.72 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +3 Query: 627 PYSAFPDQPPPNSVFVSNTPPPYPGVTGASYPTGP 731 P A P PPP S F + TP P P PTGP Sbjct: 327 PPPAPPPPPPPPSRFNNTTPKPPPPPPPPEPPTGP 361 >09_02_0603 - 11150739-11150746,11150791-11151340 Length = 185 Score = 31.5 bits (68), Expect = 0.72 Identities = 15/30 (50%), Positives = 16/30 (53%), Gaps = 4/30 (13%) Frame = +3 Query: 621 VPPYSAFPDQPPPNSVFV----SNTPPPYP 698 +PP FP PPP S FV S PPP P Sbjct: 37 LPPPFGFPPPPPPGSTFVPLPQSGVPPPPP 66 >01_07_0021 - 40533864-40534583,40534779-40534814,40534909-40535048, 40535837-40535922,40536430-40536653,40536770-40536865, 40538766-40538833,40539945-40540055,40540799-40540955 Length = 545 Score = 31.1 bits (67), Expect = 0.95 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = +3 Query: 627 PYSAFPDQPPPNSVFVSNTPPPYPGVTGASYPTGPGF 737 PY+++P PP N V N PPP+P T PGF Sbjct: 488 PYNSYPVFPPMNYPMV-NIPPPFPSAPN----TPPGF 519 >08_02_0672 - 19904353-19904839,19905646-19905704,19906137-19906352, 19906845-19907422,19907506-19908180,19908263-19908653, 19909469-19909621,19909727-19909980,19911023-19911479 Length = 1089 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 627 PYSAFPDQPPPNSVFVSNTPPPYPGVTGASYP 722 P A P PPP V V PP Y GV YP Sbjct: 80 PLGAPPPPPPPQQVQVQ-VPPQYGGVPNPGYP 110 >01_07_0081 - 40959279-40959375,40959463-40959589,40960138-40960339, 40962414-40963361 Length = 457 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = +3 Query: 624 PPYSAFPDQPPPNSVFVSNTPPPYPGVT 707 PP+ A P P PN VS+ PPP P VT Sbjct: 4 PPHDASPAPPNPNP--VSDDPPPPPPVT 29 >03_04_0025 - 16557328-16557851,16558000-16558123,16558518-16558654, 16561050-16561185,16561296-16561721 Length = 448 Score = 30.3 bits (65), Expect = 1.7 Identities = 20/74 (27%), Positives = 35/74 (47%) Frame = +1 Query: 298 TDAMRSFSFPFIALQDVTVEQPMFSANCIKGKVRAQPNGNFIGEVKFKLTFKSGGAIEYG 477 TD M + S +++ V +F+ +K + +GNF+GE F +K G + Sbjct: 58 TDVMSTASEQELSVSLVGSNLHVFTVGELKAATQGFLDGNFLGEGGFGPVYK-GNVADKA 116 Query: 478 QAMLKAAHLAFVIW 519 + LKA +A +W Sbjct: 117 KPGLKAQPIAVKLW 130 >05_01_0142 - 940421-940701,941262-941574 Length = 197 Score = 29.5 bits (63), Expect = 2.9 Identities = 18/41 (43%), Positives = 21/41 (51%), Gaps = 4/41 (9%) Frame = +3 Query: 624 PPYSAFPDQ--PPPNSVFVSNTPPP--YPGVTGASYPTGPG 734 PP+ +P Q PPP + PPP YP GA YP PG Sbjct: 30 PPHQGYPPQGYPPPPGAY---PPPPGAYPPPPGA-YPPPPG 66 >03_01_0081 + 645214-645228,645791-645856,645973-646142,646265-646319, 646434-646499,646604-646687,647091-647168,647425-647508, 648000-648302,648402-648572,649098-649288,649406-649808, 650368-650619,650696-651196,651306-651403,651810-651911, 652016-652178 Length = 933 Score = 29.5 bits (63), Expect = 2.9 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = -1 Query: 600 EEVHMLVVVRLATVQSVGYKEVAKHQLPYDESKMSSF*HGLSILN 466 EE+ L +++ GYKE A H + D K++SF L I++ Sbjct: 876 EEIQKLQHALSQKMEASGYKEKAPHNVQEDMRKLTSFLEQLEIIS 920 >01_06_0319 - 28441082-28441102,28441630-28441701,28442568-28442627, 28442918-28443105,28444300-28444327,28444880-28444907, 28444942-28445163,28445238-28445409,28446224-28447468, 28447573-28447741,28447820-28448045,28449096-28449451, 28449530-28449724,28450655-28450864,28451729-28452004 Length = 1155 Score = 29.5 bits (63), Expect = 2.9 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = -2 Query: 218 HSHRIQLTHCQKTR*CIPLRVSKLRDRRERYLKT*CNYCADYI 90 H + HC K C+ +++++ + R E+ L+T C C D++ Sbjct: 1042 HGLGVDFFHCMKCNCCLGMKLTEHKCR-EKGLETNCPICCDFL 1083 >06_03_1310 + 29238644-29240260 Length = 538 Score = 29.1 bits (62), Expect = 3.9 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +3 Query: 621 VPPYSAFPDQPPPNSVFVSNTPPPYP 698 +PP P PPP+S S+ PPP P Sbjct: 389 MPPRRTPPTPPPPSSPTPSHLPPPPP 414 >10_01_0172 - 1928648-1930751,1932019-1932243,1933709-1934676 Length = 1098 Score = 28.7 bits (61), Expect = 5.1 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 Query: 464 APPDLKVSLNLTSPIKLPLGWARTL 390 APP V+L L+ +K P GW +TL Sbjct: 913 APPRYLVALELSGMLKKPPGWIKTL 937 >09_04_0755 - 19948942-19949088,19949249-19949396,19949512-19949648, 19949933-19949995,19950175-19950288,19951410-19951514, 19951794-19951853,19952604-19952639,19953176-19953467, 19954168-19954253,19954641-19954901 Length = 482 Score = 28.7 bits (61), Expect = 5.1 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +1 Query: 388 GKVRAQPNGNFIGEVKFKLTFKSGGAIEYGQ 480 G+ RA P G GE+ F SGG I +G+ Sbjct: 69 GRRRASPAGALSGEMPASAAFVSGGIISWGK 99 >09_02_0543 + 10427321-10428315,10428440-10429154 Length = 569 Score = 28.7 bits (61), Expect = 5.1 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = +3 Query: 624 PPYSAFPDQPPPNSVFVSNTPPPYPGVTGASYPTGPG 734 PP PD PPP + P P + P GPG Sbjct: 35 PPPPPAPDMPPPPPTPAPQSSPAPPPAPDMTPPPGPG 71 >09_02_0369 - 8012470-8013120 Length = 216 Score = 28.7 bits (61), Expect = 5.1 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +3 Query: 624 PPYSAFPDQPPPNSVFVSNTPPP 692 PP+ P +PPP F++ PPP Sbjct: 43 PPHDDPPLKPPPQQQFITAQPPP 65 >12_02_0811 - 23370455-23370472,23372279-23372538,23372645-23372713, 23372979-23373105,23373187-23373422,23373509-23373678, 23373855-23373935,23374013-23374084,23374273-23374344, 23374450-23374588,23375141-23375643,23376817-23377010, 23377952-23378488 Length = 825 Score = 28.3 bits (60), Expect = 6.7 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 5/43 (11%) Frame = -2 Query: 479 CPYSIAPPDLKVSLNLTS-----PIKLPLGWARTLPFIQLAEN 366 C YS + P L +LNL+S P+ L G ++L ++ L+ N Sbjct: 445 CGYSSSDPALVTALNLSSSVLIGPVNLSFGDLKSLQYLDLSNN 487 >10_08_0936 - 21679002-21679800,21679893-21680116,21681174-21681361, 21681505-21682597 Length = 767 Score = 28.3 bits (60), Expect = 6.7 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 624 PPYSAFPDQPPPNSVFVSNTPPPYP 698 P + P PPP+S S+ PPP P Sbjct: 78 PALAPTPTPPPPSSTASSSLPPPTP 102 >04_01_0069 - 697811-697876,697956-698166,698265-698359,698448-698513, 698595-698643,698720-698770,698856-698908,699263-699331, 699874-699928,700011-700099,700217-700302,700376-700432, 700575-700716,701637-702032 Length = 494 Score = 28.3 bits (60), Expect = 6.7 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +3 Query: 633 SAFPDQPPPNSVFVSNTPPPYPGVTGASYP 722 S+ P +PPP S + PP P VT A P Sbjct: 66 SSRPPRPPPPSTTTAPPPPAAPAVTPARPP 95 >02_05_1276 + 35397948-35398298,35398937-35401738,35402085-35402306, 35402503-35402562,35402615-35402698,35402740-35402816, 35403147-35403363 Length = 1270 Score = 28.3 bits (60), Expect = 6.7 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +3 Query: 624 PPYSAFPDQPPPNSVFVSNTPPPYPGVTGASYPTGPG 734 PP S+ P PPP + TPP + GV + G G Sbjct: 22 PPASSSPSPPPP-----AATPPSHDGVVAVGFVGGGG 53 >11_06_0671 + 26099292-26099491,26099589-26099622,26104787-26104813, 26105557-26105642,26105735-26105783,26105969-26106018, 26106692-26107185,26107379-26107539,26107808-26108017, 26108100-26108292,26108367-26108444,26108555-26108649, 26109158-26109280 Length = 599 Score = 27.9 bits (59), Expect = 8.9 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +3 Query: 621 VPPYSAFPDQPPPNSVFVSNTPPPY 695 +PP P PPP+ V PPPY Sbjct: 1 MPPKRKSPPPPPPHGPVVVVPPPPY 25 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 27.9 bits (59), Expect = 8.9 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +3 Query: 624 PPYSAFPDQPPPNSVFVSNTPPPYPGVTGASYP 722 PP FP QPPP + + PPP G P Sbjct: 13 PPQGGFPPQPPPMNPY--GPPPPQQPAYGHMPP 43 >05_03_0418 + 13700855-13700942,13701602-13701728,13701845-13701916, 13702079-13702153,13702290-13702361,13702477-13702638, 13702726-13702800,13702880-13702951,13703040-13703108, 13703196-13703264,13703355-13703429,13703522-13703593, 13703668-13703737,13703920-13704361,13704442-13704573, 13704664-13704803,13704910-13705129,13705301-13705536, 13705732-13706256 Length = 930 Score = 27.9 bits (59), Expect = 8.9 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +2 Query: 389 VKFVPNLMATLLVRSNSSLPSNQEVLLSMD 478 VKF+P+L A L + NS P+N ++ S D Sbjct: 429 VKFLPSLQANLSSKLNSCTPNNLGLVYSND 458 >04_01_0162 + 1845295-1846317,1846430-1846565,1848436-1848626, 1848780-1848887,1849001-1849204,1849294-1849525, 1849602-1849751,1849830-1850007,1850416-1850519, 1850611-1850933,1851274-1851459,1851672-1851899 Length = 1020 Score = 27.9 bits (59), Expect = 8.9 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +3 Query: 624 PPYSAFPDQPPPNSVFVSNTPPPYPGVTGASYPTGP 731 PP F PP F + PPP T A GP Sbjct: 76 PPQRPFGAGPPQQGPFAAAAPPPQGPFTSAPSSQGP 111 >03_01_0515 - 3864796-3865425 Length = 209 Score = 27.9 bits (59), Expect = 8.9 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +3 Query: 624 PPYSAFPDQPPPNSVFVSNTPPPYPGVTGASYP 722 PP S PPP + + PPP P VT + P Sbjct: 53 PPPSVTSSPPPPAAGPLMPPPPPPPSVTSSPPP 85 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 27.9 bits (59), Expect = 8.9 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +3 Query: 624 PPYSAFPDQPPPNSVFVSNTPPPYPGVTGASYPTGPG 734 PP P PPP PPP P + P PG Sbjct: 358 PPKGPSPPPPPPPGGKKGGPPPPPPKGGASRPPAAPG 394 >01_06_0347 + 28592552-28593502 Length = 316 Score = 27.9 bits (59), Expect = 8.9 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +3 Query: 630 YSAFPDQPPPNSVFVSNTPPP 692 YS+ P PP S+ V+ TPPP Sbjct: 25 YSSAPTPPPSPSLVVAPTPPP 45 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,633,219 Number of Sequences: 37544 Number of extensions: 410468 Number of successful extensions: 1848 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 1452 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1790 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1945321620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -