BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0823 (702 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein... 113 7e-27 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 4.0 AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein pr... 24 4.0 DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. 23 9.3 >AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein 70 protein. Length = 78 Score = 113 bits (271), Expect = 7e-27 Identities = 53/60 (88%), Positives = 56/60 (93%) Frame = +2 Query: 509 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFDVS 688 YFNDSQRQATKDAG I+GLNV+RIINEPTAAA+AYGLDK GERNVLIFDLGGGTFDVS Sbjct: 9 YFNDSQRQATKDAGAIAGLNVMRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVS 68 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 24.2 bits (50), Expect = 4.0 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = +3 Query: 66 NGKSTRSRNRSGYHVLLRWCLPAREGGDHR--QRPG 167 +GK RS + +++LL P REG H+ Q PG Sbjct: 1802 DGKYKRSYSYEPHNLLLSNLFPPREGFHHKAVQLPG 1837 >AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein protein. Length = 476 Score = 24.2 bits (50), Expect = 4.0 Identities = 20/92 (21%), Positives = 37/92 (40%), Gaps = 1/92 (1%) Frame = +2 Query: 89 ESIWVPRTLALVSSSTGRWRSSPT-TRATGPLRLMLRSQTPSVSSEMPPRTRWR*TQQHN 265 E++W + A S T W+ RAT L L+ Q P + + W Q+H+ Sbjct: 30 ENLWKFESTAAPESLTETWKEGDAKARATIAL-LVDDCQHPLIRDCKTAKGTWDALQKHH 88 Query: 266 IRCQTSHRT*VRRCYCASRHEALAFRGCHXWR 361 + S + + + C + ++ H +R Sbjct: 89 QKTTMSTKVSLLKKLCKAEYDESGDMEAHLFR 120 >DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. Length = 847 Score = 23.0 bits (47), Expect = 9.3 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = -3 Query: 442 FVSTMELTSSGKKVLSSPLYATLILGLPPSVTTSK 338 F S + T S SS L +T+ LPP VTT++ Sbjct: 803 FASRLRATESTATESSSTL-STVTTTLPPVVTTAR 836 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 790,174 Number of Sequences: 2352 Number of extensions: 17648 Number of successful extensions: 27 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71504505 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -