BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0821 (728 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC622.04 |||dubious|Schizosaccharomyces pombe|chr 3|||Manual 27 3.6 SPAC29A4.19c |||P-type ATPase |Schizosaccharomyces pombe|chr 1||... 25 8.4 >SPCC622.04 |||dubious|Schizosaccharomyces pombe|chr 3|||Manual Length = 140 Score = 26.6 bits (56), Expect = 3.6 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +2 Query: 503 LIVFLRCFVVFNCCLVSTNYYFE 571 L VFL F++F C+V YYFE Sbjct: 34 LYVFL--FIIFANCVVDVKYYFE 54 >SPAC29A4.19c |||P-type ATPase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1096 Score = 25.4 bits (53), Expect = 8.4 Identities = 11/42 (26%), Positives = 26/42 (61%), Gaps = 2/42 (4%) Frame = +2 Query: 446 LLNSMINK-MHDMYLICIMYLIVFL-RCFVVFNCCLVSTNYY 565 ++ ++N+ +H YL + ++++L FV ++CC+V + Y Sbjct: 191 IVTILLNEVLHPFYLFQAVSVLIWLCDSFVFYSCCIVFISSY 232 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,645,074 Number of Sequences: 5004 Number of extensions: 51105 Number of successful extensions: 120 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 116 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 120 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 343230174 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -