BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0821 (728 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value S78458-1|AAB34402.1| 46|Apis mellifera apamin protein. 23 2.2 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 23 2.9 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 22 5.2 DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholi... 21 9.0 DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholi... 21 9.0 >S78458-1|AAB34402.1| 46|Apis mellifera apamin protein. Length = 46 Score = 23.4 bits (48), Expect = 2.2 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = +2 Query: 503 LIVFLRCFVVFNCCLVSTNYYFEYIKPYVC 592 +I LRC +F ++ T+Y+ + P C Sbjct: 1 MISMLRCIYLFLSVILITSYFVTPVMPCNC 30 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 23.0 bits (47), Expect = 2.9 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = -2 Query: 679 SNEIRVGSKLDIN*NYGN*LYIVELYNYTTNIWFDIFEIVISR 551 S E ++ S L N NY N Y NY +++ + I I + Sbjct: 309 SKERKIISSLSNNYNYNNNNYKYNYNNYNKKLYYKNYIINIEQ 351 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 22.2 bits (45), Expect = 5.2 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 509 VFLRCFVVFNCCLVSTNY 562 VFL C+V F C + T+Y Sbjct: 280 VFLICWVPFFCVNIVTSY 297 >DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 21.4 bits (43), Expect = 9.0 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = -2 Query: 268 FVHLYTLWQSRVRN*EKKTINTSIKS*NYL 179 F H Y +++S EK+ +N + S N L Sbjct: 40 FHHTYIIYESLCGRHEKRLLNELLSSYNTL 69 >DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 21.4 bits (43), Expect = 9.0 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = -2 Query: 268 FVHLYTLWQSRVRN*EKKTINTSIKS*NYL 179 F H Y +++S EK+ +N + S N L Sbjct: 40 FHHTYIIYESLCGRHEKRLLNELLSSYNTL 69 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,716 Number of Sequences: 438 Number of extensions: 4149 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22657590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -