BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0819 (728 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC589.09 |||sec14 cytosolic factor family|Schizosaccharomyces ... 27 3.6 SPAC8E11.01c ||SPAC959.01|beta-fructofuranosidase|Schizosaccharo... 26 4.8 SPAC6G9.04 |mug79||meiotically upregulated gene Mug79|Schizosacc... 26 6.3 SPAC1250.02 |mug95||sequence orphan|Schizosaccharomyces pombe|ch... 26 6.3 SPAC1834.08 |mak1|phk3|histidine kinase Mak1|Schizosaccharomyces... 25 8.4 SPAC17A2.02c |||DUF887 family protein|Schizosaccharomyces pombe|... 25 8.4 SPAC1F8.06 |fta5|sma5|Sim4 and Mal2 associated |Schizosaccharomy... 25 8.4 >SPAC589.09 |||sec14 cytosolic factor family|Schizosaccharomyces pombe|chr 1|||Manual Length = 388 Score = 26.6 bits (56), Expect = 3.6 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +3 Query: 66 DYAHMKFNKKCTQSIHYYNYGLLVCLFNKSLYI 164 DY+ +K+ C + +YY L VC+ +KS +I Sbjct: 217 DYSFVKYLASCLE--YYYPQSLGVCILHKSPWI 247 >SPAC8E11.01c ||SPAC959.01|beta-fructofuranosidase|Schizosaccharomyces pombe|chr 1|||Manual Length = 508 Score = 26.2 bits (55), Expect = 4.8 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -1 Query: 554 LGWGSRCNYTETLELNLKVAGAFTL 480 + W S NYT + + +K G FT+ Sbjct: 282 ISWASNWNYTNDVPMRMKHRGMFTI 306 >SPAC6G9.04 |mug79||meiotically upregulated gene Mug79|Schizosaccharomyces pombe|chr 1|||Manual Length = 1318 Score = 25.8 bits (54), Expect = 6.3 Identities = 17/43 (39%), Positives = 20/43 (46%) Frame = +2 Query: 518 RSQYSYNGCPTPNRNALLLHGRNRQGGGTYPCGLTKGHTTNKL 646 R Q Y+G N A + R R Y L+KGHTTN L Sbjct: 246 RIQGKYSG---ENVRARIELARERNRKRDYVSNLSKGHTTNAL 285 >SPAC1250.02 |mug95||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 178 Score = 25.8 bits (54), Expect = 6.3 Identities = 15/50 (30%), Positives = 22/50 (44%), Gaps = 3/50 (6%) Frame = +2 Query: 554 NRNALLLHGRNRQGGGTYPCGL---TKGHTTNKLIIFSAVKFKLLLTKVG 694 N ++LHG N Q CGL T +T I F++ + T+ G Sbjct: 106 NGELIVLHGINHQAAMLTACGLFMVTSSNTNKWKIAFASFLLGMFFTQFG 155 >SPAC1834.08 |mak1|phk3|histidine kinase Mak1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1639 Score = 25.4 bits (53), Expect = 8.4 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = -3 Query: 303 HQQRHLPGSFANLNHPGATQTHTKKIIQINPVV*EEF 193 H++ GSF N+N G++ + K+ + PV E F Sbjct: 595 HKEGECVGSFCNINAKGSSLNNIPKLPRFVPVPSEFF 631 >SPAC17A2.02c |||DUF887 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 290 Score = 25.4 bits (53), Expect = 8.4 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +2 Query: 212 GLI*MIFFVCVWVAPGWF 265 G I ++ F+CV +A GWF Sbjct: 203 GFILIVTFICVRIAWGWF 220 >SPAC1F8.06 |fta5|sma5|Sim4 and Mal2 associated |Schizosaccharomyces pombe|chr 1|||Manual Length = 385 Score = 25.4 bits (53), Expect = 8.4 Identities = 9/41 (21%), Positives = 21/41 (51%) Frame = +3 Query: 234 LYAFGWRLDGLDSQMSPADGAVDGYLGYLSIRQLNGWNDLN 356 +Y F +R+ D+ D + G+ + ++GW+++N Sbjct: 258 VYQFFFRVPATDNWSLFVKNVDDAFFGWFGDKAISGWSNVN 298 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,003,722 Number of Sequences: 5004 Number of extensions: 62367 Number of successful extensions: 128 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 125 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 128 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 343230174 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -