BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0819 (728 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0140 - 18528312-18528353,18528426-18529052,18529914-185299... 28 6.6 01_06_1355 + 36610390-36610479,36611906-36612063,36612144-366125... 28 8.7 >01_05_0140 - 18528312-18528353,18528426-18529052,18529914-18529962, 18530086-18530108 Length = 246 Score = 28.3 bits (60), Expect = 6.6 Identities = 21/61 (34%), Positives = 35/61 (57%) Frame = +1 Query: 28 LNSVRGKRLLTRPTMHI*NSTKNVLSLYTIIIMGC*FVYLINLYIYNSTVRV*VTELLLN 207 LN++RG L+ P + + TK L ++II GC L++L++ N V +TEL ++ Sbjct: 118 LNNLRGLVLVECPLLDMSTGTKFPDLLSSLIIRGC--HQLLSLHLCNPAV---LTELEIS 172 Query: 208 D 210 D Sbjct: 173 D 173 >01_06_1355 + 36610390-36610479,36611906-36612063,36612144-36612523, 36612600-36613583,36614228-36614292,36614946-36615024, 36615480-36615529,36616595-36616781,36617922-36617957, 36619226-36619348,36619466-36620386,36620506-36620636 Length = 1067 Score = 27.9 bits (59), Expect = 8.7 Identities = 20/64 (31%), Positives = 29/64 (45%) Frame = +2 Query: 515 LRSQYSYNGCPTPNRNALLLHGRNRQGGGTYPCGLTKGHTTNKLIIFSAVKFKLLLTKVG 694 L SQ G P PN +A ++G G +Y C TTN++ F + K L ++ Sbjct: 175 LESQSFSTGIPAPNADAYTING---MPGDSYLC----PETTNRIAKFEVRRDKTYLLRII 227 Query: 695 NDCL 706 N L Sbjct: 228 NAAL 231 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,870,972 Number of Sequences: 37544 Number of extensions: 416834 Number of successful extensions: 785 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 777 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 785 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1909952136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -