BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0816 (681 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0802 - 28155281-28155725,28155750-28156081,28156164-281562... 30 2.0 12_01_0171 - 1268803-1269500,1271491-1271567,1271941-1272065,127... 29 2.6 07_01_0077 + 566895-567127,567207-567331,571204-571340,571437-57... 29 4.5 11_01_0389 - 2937242-2939476,2939556-2939666,2941254-2941450,294... 28 7.9 >04_04_0802 - 28155281-28155725,28155750-28156081,28156164-28156266, 28156347-28156528,28156617-28156800,28156872-28156960, 28157634-28157710,28157837-28157927,28158230-28158430 Length = 567 Score = 29.9 bits (64), Expect = 2.0 Identities = 17/50 (34%), Positives = 24/50 (48%) Frame = +3 Query: 408 DESIVSQDKVAFTNDNGNLYQSKESRSENSGTSTRILCPKLFMYRQTAYK 557 D + + V TN+NGN+ + R + GTS IL KL R +K Sbjct: 394 DYIVCDKSDVFVTNNNGNMARMLAGRRNSLGTSGHILKRKLNFRRYFGHK 443 >12_01_0171 - 1268803-1269500,1271491-1271567,1271941-1272065, 1272146-1272234,1272851-1272936,1273509-1273765 Length = 443 Score = 29.5 bits (63), Expect = 2.6 Identities = 15/55 (27%), Positives = 27/55 (49%) Frame = +3 Query: 288 RDPQDYTALNERKSQDKHTENLIPNLTNSHKSYGYTGIDKDESIVSQDKVAFTND 452 ++PQ AL+E D +EN + L++S + T D +E + + D N+ Sbjct: 264 QEPQVVPALHEEPQDDDRSENAVQELSSSEAN---TSSDNNEPLAADDSAECMNE 315 >07_01_0077 + 566895-567127,567207-567331,571204-571340,571437-571542, 571635-571885,572018-572128,572209-572320,572626-572716, 573168-573507,573678-573900,573946-574204,574274-574481, 574572-574622,574712-574870,574956-575120,575322-575399, 575732-576031,576107-576259,576871-576918,577019-577188, 577738-577852,578462-578623,578789-578893,578969-579199, 579277-579410,579484-579738,579822-580110,580214-580306, 580395-580520,580646-580897 Length = 1693 Score = 28.7 bits (61), Expect = 4.5 Identities = 11/42 (26%), Positives = 22/42 (52%) Frame = +3 Query: 267 PSQIPEHRDPQDYTALNERKSQDKHTENLIPNLTNSHKSYGY 392 P +P +DP + N+ + +KH ++ PN + K +G+ Sbjct: 112 PRPLPPSQDPLEGQE-NQNQEHEKHFAHVAPNFNSMRKDHGF 152 >11_01_0389 - 2937242-2939476,2939556-2939666,2941254-2941450, 2941543-2941633 Length = 877 Score = 27.9 bits (59), Expect = 7.9 Identities = 20/87 (22%), Positives = 38/87 (43%), Gaps = 4/87 (4%) Frame = +3 Query: 249 PSNVENPSQIPEHRDPQDYTALNE---RKSQDKHTENLIPNLTNSHKSYGYTGIDKDESI 419 P++ SQ+PE +D +E KS ++ + N YG GI K + Sbjct: 336 PASTSEISQLPEFITARDTVMNSEPRINKSHPNSPKHDTVDKANQDVDYGSVGIQKAAAF 395 Query: 420 VSQDKVAFT-NDNGNLYQSKESRSENS 497 +S+D+ T + + E+ +E++ Sbjct: 396 LSEDRNGATQGEKSEIKDPPENTAEHT 422 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,557,390 Number of Sequences: 37544 Number of extensions: 326058 Number of successful extensions: 700 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 684 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 700 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1721314888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -