BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0815 (736 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_06_0230 + 21717225-21717301,21717888-21717972,21718045-217181... 29 5.1 02_05_0540 + 29852109-29852195,29852304-29852477,29852585-298528... 28 8.8 >09_06_0230 + 21717225-21717301,21717888-21717972,21718045-21718165, 21718244-21718368,21718940-21718984,21719082-21719345, 21720067-21720111,21720182-21720212,21721644-21721693, 21722433-21724310,21724406-21724564,21724821-21724939, 21726917-21727059,21727670-21727735,21728184-21728317, 21728454-21728591,21728927-21729186,21729295-21729406, 21730727-21730909 Length = 1344 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/56 (32%), Positives = 22/56 (39%) Frame = +1 Query: 337 LNKKSNGRNRATDGPLTATTLLAAVRRECKRRSLTIIKVFLSPLVTADPRKWPKRT 504 L K NG + TDG TT + K I K+ SP VT K + T Sbjct: 127 LTLKQNGDTKKTDGTTIQTTCKYCSKDGAKLYPSVIFKMLTSPRVTLSRSKLHRNT 182 >02_05_0540 + 29852109-29852195,29852304-29852477,29852585-29852841, 29852954-29853125,29853513-29853551,29853647-29853715, 29853795-29853911,29854190-29854401,29854578-29854736, 29854810-29855009,29855100-29855266,29855346-29855442, 29855560-29855651,29855861-29856139 Length = 706 Score = 27.9 bits (59), Expect = 8.8 Identities = 19/65 (29%), Positives = 29/65 (44%) Frame = -2 Query: 327 SLTLDINNRPATWNAPGMLFKARGLRRGRIQKRIRSMYSTYFHEAFPTIEVWQKALEIIS 148 SL D T N PG++ K RGL ++ I + S + +A IE E ++ Sbjct: 32 SLKRDSGGHATTKNLPGLMKKLRGLNEVISEEEIAAHLSQSYPDADQEIEFESFLREYLN 91 Query: 147 LKGFV 133 L+ V Sbjct: 92 LQSRV 96 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,686,466 Number of Sequences: 37544 Number of extensions: 328734 Number of successful extensions: 863 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 837 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 863 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1933531792 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -