BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0814 (699 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant r... 24 5.3 M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles ... 23 7.0 AY578807-1|AAT07312.1| 438|Anopheles gambiae punt protein. 23 9.2 >AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant receptor Or3 protein. Length = 411 Score = 23.8 bits (49), Expect = 5.3 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +3 Query: 75 RRVRDRFATF*CCCDFN 125 RRV DRF+ CCC F+ Sbjct: 139 RRV-DRFSKIYCCCHFS 154 >M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 442 Score = 23.4 bits (48), Expect = 7.0 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = +2 Query: 257 HTRCTGSQARSSHQRGPGNSVHAYRSSPGDFERHTLSL 370 HT CTG S+ + G N + + +F T SL Sbjct: 61 HTHCTGLSRDSTRELGRNNQLLWLCKNCNEFRNGTNSL 98 >AY578807-1|AAT07312.1| 438|Anopheles gambiae punt protein. Length = 438 Score = 23.0 bits (47), Expect = 9.2 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 380 ERVEVITYASQNLRDCSC 327 E ++ TYA +NL C C Sbjct: 19 ECIDTTTYAKKNLNYCCC 36 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 759,874 Number of Sequences: 2352 Number of extensions: 16189 Number of successful extensions: 27 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -