BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0814 (699 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 24 1.6 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 22 4.9 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 22 4.9 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 22 6.4 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 23.8 bits (49), Expect = 1.6 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -3 Query: 115 QQH*NVANLSRTLRPEAGKPLTLQIQQ 35 QQ + + R + GKP+ +QIQQ Sbjct: 1074 QQSIQTSGMQRIIAQIGGKPIAVQIQQ 1100 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 22.2 bits (45), Expect = 4.9 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +2 Query: 473 SGQHDHTINSPAD 511 SG++DHT N P D Sbjct: 60 SGEYDHTKNYPFD 72 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 22.2 bits (45), Expect = 4.9 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +2 Query: 473 SGQHDHTINSPAD 511 SG++DHT N P D Sbjct: 57 SGEYDHTKNYPFD 69 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 21.8 bits (44), Expect = 6.4 Identities = 17/58 (29%), Positives = 26/58 (44%), Gaps = 1/58 (1%) Frame = -2 Query: 314 NFQGLADGCS*LGIQYT-ECAFDRFFLFGRPPSRNRFKSSGRIPSDTALIFSKATIAD 144 +F+ A S LG + T E D F GRP +++ SSG + ++F D Sbjct: 398 SFREFAVSTSILGDKKTAEENTDYFMPIGRPRAKDYGHSSGSVIDRNGVMFFNMVTRD 455 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 195,374 Number of Sequences: 438 Number of extensions: 4105 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -